FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2
- Product Name
- FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2
- CAS No.
- 357952-10-4
- Chemical Name
- FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2
- Synonyms
- UCN-II;UCN-II MOUSE;SCP (3-40) (MOUSE);UROCORTIN III (MOUSE);Stresscopin (3-40) (mouse);Urocortin III, mouse, Amide;UCN III (MOUSE) TRIFLUOROACETATE SALT;SCP (3-40) (MOUSE) TRIFLUOROACETATE SALT;FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2;UROCORTIN III (MOUSE) TRIFLUOROACETATE SALT
- CBNumber
- CB0127721
- Molecular Formula
- C186H312N52O52S2
- Formula Weight
- 4172.91468
- MOL File
- 357952-10-4.mol
FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2 Property
- storage temp.
- −20°C
- solubility
- Soluble in DMSO
- form
- solid
- Sequence
- Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Ile-Leu-Phe-Asn-Ile-Asp-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Lys-Ala-Ala-Ala-Asn-Ala-Gln-Leu-Met-Ala-Gln-Ile-NH2
Safety
- Safety Statements
- 22-24/25
- WGK Germany
- 3
N-Bromosuccinimide Price
- Product number
- 24750
- Product name
- Urocortin III (mouse) (trifluoroacetate salt)
- Purity
- ≥95%
- Packaging
- 500μg
- Price
- $459
- Updated
- 2024/03/01
- Product number
- 24750
- Product name
- Urocortin III (mouse) (trifluoroacetate salt)
- Purity
- ≥95%
- Packaging
- 1 mg
- Price
- $689
- Updated
- 2024/03/01
- Product number
- 24749
- Product name
- Urocortin III (mouse) (trifluoroacetate salt)
- Packaging
- 500μg
- Price
- $485
- Updated
- 2024/03/01
FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2 Chemical Properties,Usage,Production
Uses
Urocortin III, mouse is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2[1]. Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics[2].
References
[1] Proc Natl Acad Sci U S A. 2001 Jun 19;98(13):7570-5. Lewis K, et al. Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor. Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor. DOI:10.1073/pnas.121165198
[2] Shemesh Y, et al. Ucn3 and CRF-R2 in the medial amygdala regulate complex social dynamics. Nat Neurosci. 2016 Nov;19(11):1489-1496. DOI:10.1038/nn.4346
FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2 Preparation Products And Raw materials
Raw materials
Preparation Products
FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2 Suppliers
- Tel
- 21-61263452 13641803416
- Fax
- 86-21-61263399
- ymbetter@glbiochem.com
- Country
- China
- ProdList
- 9981
- Advantage
- 64
- Tel
- 021-54306202 13764082696
- info@hanhongsci.com
- Country
- China
- ProdList
- 42934
- Advantage
- 64
- Tel
- 021-50135380
- shchemsky@sina.com
- Country
- China
- ProdList
- 15402
- Advantage
- 60
- Tel
- 0551-65326643 18156095617
- Fax
- 0551-65326641
- info@cellmano.com
- Country
- China
- ProdList
- 1010
- Advantage
- 55
- Tel
- 0510-85629785 18013409632
- Fax
- 051085625359
- sales@reading-chemicals.com
- Country
- China
- ProdList
- 15178
- Advantage
- 58
- Tel
- 021-61415566 800-8193336
- orderCN@merckgroup.com
- Country
- China
- ProdList
- 51395
- Advantage
- 80
- Tel
- 17705183659
- Fax
- 84523390
- sales@njleonbiotech.com
- Country
- China
- ProdList
- 5501
- Advantage
- 55
- Tel
- 025-58361106-805 15951641583
- Fax
- 025-58361106-806
- zhao.xu@njpeptide.com
- Country
- China
- ProdList
- 9979
- Advantage
- 55
- Tel
- +86-17380623303
- Fax
- 028-62328193
- Caroline@youngshechem.com
- Country
- China
- ProdList
- 4802
- Advantage
- 58
- Tel
- 0571-87213919
- Eric@peptidego.com
- Country
- China
- ProdList
- 7408
- Advantage
- 58
- Tel
- 400-9205774
- sales@glpbio.cn
- Country
- China
- ProdList
- 6777
- Advantage
- 58
- Tel
- 15911056312
- liming@bio-fount.com
- Country
- China
- ProdList
- 9729
- Advantage
- 58
- Tel
- meitaochem@126.com
- meitaochem@126.com
- Country
- China
- ProdList
- 19103
- Advantage
- 58
- Tel
- +1-2135480471
- sales@sarms4muscle.com
- Country
- China
- ProdList
- 10473
- Advantage
- 58
- Tel
- 0571-88211921
- sales1@gotopbio.com
- Country
- CHINA
- ProdList
- 2609
- Advantage
- 58
- Tel
- +86-0371-86658258 +8613203830695
- Fax
- 0371-86658258
- laboratory@coreychem.com
- Country
- China
- ProdList
- 30229
- Advantage
- 58
- Tel
- 0551-65326643 18156095617
- Fax
- 0551-65326641
- info@cellmano.com
- Country
- China
- ProdList
- 995
- Advantage
- 58
- Tel
- 18818260767
- Fax
- QQ 3610331285
- sales@chemegen.com
- Country
- China
- ProdList
- 11218
- Advantage
- 58
- Tel
- 13758194781 13173652190
- 522013271@qq.com
- Country
- China
- ProdList
- 2395
- Advantage
- 58
- Tel
- 0510-85629785 18013409632
- Fax
- 0510-85625359
- sales@reading-chemicals.com
- Country
- China
- ProdList
- 14081
- Advantage
- 58
- Tel
- 0571-88760729 18072970094
- supports@ontorespeptide.com
- Country
- China
- ProdList
- 2696
- Advantage
- 58
- Tel
- 15397062932
- sales1@gotopbio.com
- Country
- China
- ProdList
- 2923
- Advantage
- 58
- Tel
- 021-69568360 18916172912
- order@med-bio.cn
- Country
- China
- ProdList
- 8140
- Advantage
- 58
- Tel
- 021-61109150
- Fax
- 021-61105897
- sales@tcisct.com
- Country
- China
- ProdList
- 29668
- Advantage
- 58
- Tel
- 010-60605840 15801484223;
- psaitong@jm-bio.com
- Country
- China
- ProdList
- 29757
- Advantage
- 58
- Tel
- 13675144456
- alan.chow@synzest.com
- Country
- China
- ProdList
- 9470
- Advantage
- 58
- Tel
- 18168071971
- support@yuan-peptide.com
- Country
- China
- ProdList
- 2983
- Advantage
- 58
- Tel
- 17711399154
- 3211919385@qq.com
- Country
- China
- ProdList
- 1815
- Advantage
- 58
- Tel
- 0571-0571-88211921 19105816207
- sales4@gotopbio.com
- Country
- China
- ProdList
- 5144
- Advantage
- 58
- Tel
- 0571-87213919 17306812703
- 3007955328@qq.com
- Country
- China
- ProdList
- 6979
- Advantage
- 58
- Tel
- 13186333400
- cuichengbio@163.com
- Country
- China
- ProdList
- 4846
- Advantage
- 58
- Tel
- 0571-85350119 15888826472
- 15888826472@163.com
- Country
- China
- ProdList
- 2729
- Advantage
- 58
- Tel
- 13770887460
- wenxi@jszkhy.com
- Country
- China
- ProdList
- 1354
- Advantage
- 58
- Tel
- 17751201929
- office@combiosz.com
- Country
- China
- ProdList
- 3000
- Advantage
- 58
- Tel
- 021-54306202 18917919676
- info@hanhongsci.com
- Country
- China
- ProdList
- 29995
- Advantage
- 58
- Tel
- 13053322091
- admin@mopaikeji.com
- Country
- China
- ProdList
- 5830
- Advantage
- 58
- Tel
- 0571-88211951 13735575465
- sales1@gotopbio.com
- Country
- China
- ProdList
- 4880
- Advantage
- 58
- Tel
- 13119135307
- Country
- China
- ProdList
- 2767
- Advantage
- 58
- Tel
- 19135651983
- 18611134419@163.com
- Country
- China
- ProdList
- 4416
- Advantage
- 58
- Tel
- 18059081430
- 2070812664@qq.com
- Country
- China
- ProdList
- 1232
- Advantage
- 58
- Tel
- 0571-85350119 15888826472
- bptsales@163.com
- Country
- China
- ProdList
- 3834
- Advantage
- 58
- Tel
- 800-364-9897
- sales@caymanchem.com
- Country
- China
- ProdList
- 6838
- Advantage
- 58
- Tel
- Enzo Biochem Inc. 13797054060
- Enzoname@qq.com
- Country
- China
- ProdList
- 6174
- Advantage
- 58
- Tel
- 51288865780
- sales@biosynth.com
- Country
- China
- ProdList
- 6051
- Advantage
- 58
- Tel
- 17320513646
- anna@molcoo.com
- Country
- China
- ProdList
- 3268
- Advantage
- 58
- Tel
- 0512-67583809
- sales@cohesionbio.com
- Country
- China
- ProdList
- 6282
- Advantage
- 58
- Tel
- 19941518170
- sales@typeptide.com
- Country
- China
- ProdList
- 3920
- Advantage
- 58
- Tel
- 17342063383
- sales@allpeptide.com
- Country
- China
- ProdList
- 5320
- Advantage
- 58
- Tel
- 13758194781 15083780366
- wudegui@tanzhenbio.com
- Country
- China
- ProdList
- 1591
- Advantage
- 58
- Tel
- +8615051830413
- sales.njleonbiotech@gmail.com
- Country
- China
- ProdList
- 5482
- Advantage
- 58