UROTENSIN II (HUMAN)

ChemicalBook > CAS DataBase List > UROTENSIN II (HUMAN)

Product Name: UROTENSIN II (HUMAN)
CAS No.: 251293-28-4
Chemical Name: UROTENSIN II (HUMAN)
Synonyms: UTS2;Urotensin-2;U-II (huMan);UROTENSIN II (HUMAN);Urotensin II, human (3);Urotensin II (human) TFA;UrotensinII, human Bridge;Urotensin II (114-124), human;M.W. 1388.57 C64H85N13O18S2;Urotensin II human, ≥97% (HPLC)
CBNumber: CB2397456
Molecular Formula: C64H85N13O18S2
Formula Weight: 1388.57
MOL File: 251293-28-4.mol

Less

UROTENSIN II (HUMAN) Property

Boiling point:: 1760.5±65.0 °C(Predicted)
Density: 1.46±0.1 g/cm3(Predicted)
storage temp.: -15°C
pka: 3.60±0.10(Predicted)
form: Solid
biological source: synthetic
Water Solubility: Soluble to 1 mg/ml in water

Less

Hazard and Precautionary Statements (GHS)

Less

N-Bromosuccinimide Price

Sigma-Aldrich

Product number: U7257
Product name: Urotensin II human
Purity: ≥97% (HPLC), synthetic
Packaging: 0.5MG
Price: $255
Updated: 2023/06/20

Sigma-Aldrich

Product number: U7257
Product name: Urotensin II human
Purity: ≥97% (HPLC), synthetic
Packaging: 1MG
Price: $397
Updated: 2023/06/20

Sigma-Aldrich

Product number: SAB1307211
Product name: ANTI-UTS2(N-TERMINAL) antibody produced in rabbit
Purity: purified immunoglobulin, buffered aqueous solution
Packaging: 400μL
Price: $461
Updated: 2023/01/07

Alfa Aesar

Product number: J66618
Product name: Urotensin II
Purity: human
Packaging: 1mg
Price: $211
Updated: 2023/06/20

Tocris

Product number: 1642
Product name: UrotensinII(human)
Packaging: 1
Price: $300
Updated: 2021/12/16

Less

UROTENSIN II (HUMAN) Chemical Properties,Usage,Production

Uses

Urotensin II human was used in agonist and antagonist preparation for calcium mobilization assay. The product can also be used as a test compound for studying the impact of dihydropyridine calcium antagonist amlodipine in human internal mammary artery and clinical implications.

Biochem/physiol Actions

Human urotensin II is a vasoactive neuropeptide that belongs to CRF family and stimulates arterial smooth muscle contraction, actin stress fiber formation and proliferation via small GTPase RhoA and there downstream effector Rho-kinase activation.The product is also a selective and potent vasoconstrictor agent as well as an agonist for the orphan receptor GPR14.

storage

Desiccate at -20°C

UROTENSIN II (HUMAN) Preparation Products And Raw materials

Raw materials

Preparation Products

Less

UROTENSIN II (HUMAN) Suppliers

China 77 Europe 2 France 1 Germany 4 Japan 1 Switzerland 1 United Kingdom 1 United States 14 USA 1 Global 102

3B Pharmachem (Wuhan) International Co.,Ltd.

Tel: 821-50328103-801 18930552037
Fax: 86-21-50328109
Email: 3bsc@sina.com
Country: China
ProdList: 15839
Advantage: 69

GL Biochem (Shanghai) Ltd

Tel: 21-61263452 13641803416
Fax: 86-21-61263399
Email: ymbetter@glbiochem.com
Country: China
ProdList: 9981
Advantage: 64

Shanghai Hanhong Scientific Co.,Ltd.

Tel: 021-54306202 13764082696
Email: info@hanhongsci.com
Country: China
ProdList: 42958
Advantage: 64

Chemsky（shanghai）International Co.,Ltd.

Tel: 021-50135380
Email: shchemsky@sina.com
Country: China
ProdList: 32321
Advantage: 50

Cellmano Biotech Limited

Tel: 0551-65326643 18156095617
Fax: 0551-65326641
Email: info@cellmano.com
Country: China
ProdList: 1011
Advantage: 55

Wuxi Zhongkun Biochemical Technology Co., Ltd.

Tel: 0510-85629785 18013409632
Fax: 051085625359
Email: sales@reading-chemicals.com
Country: China
ProdList: 15178
Advantage: 58

Sigma-Aldrich

Tel: 021-61415566 800-8193336
Email: orderCN@merckgroup.com
Country: China
ProdList: 51456
Advantage: 80

Nanjing Leon Biological Technology Co., Ltd.

Tel: 17705183659
Fax: 84523390
Email: sales@njleonbiotech.com
Country: China
ProdList: 5501
Advantage: 55

Nanjing Peptide Biotech Ltd.

Tel: 025-025-58361106-805-805 13082558573
Fax: 025-58361106-806
Email: liugang@njpeptide.com
Country: China
ProdList: 9980
Advantage: 55

Chengdu Youngshe Chemical Co., Ltd.

Tel: +86-17380623303 +86-17380623303
Fax: 028-62328193
Email: Caroline@youngshechem.com
Country: China
ProdList: 4810
Advantage: 58

Hubei widely chemical technology Co., Ltd.

Tel: 027-83778895 18602735115
Fax: 027-51119224
Email: 18602735115@163.com
Country: China
ProdList: 1999
Advantage: 64

Hangzhou Peptidego Biotech Co.,Ltd.

Tel: 0571-87213919
Fax: 0571-87213919
Email: Eric@peptidego.com
Country: China
ProdList: 6958
Advantage: 58

Sichuan Jisheng Biopharmaceutical Co.,Ltd.

Tel: +86-0833-2598983 +86-18086877136
Fax: +86-833-2598903
Email: Nyx-peptide@jsjpharm.cn
Country: China
ProdList: 309
Advantage: 58

Nanjing Meihao Pharmaceutical Technology Co., Ltd.

Tel: meitaochem@126.com
Email: meitaochem@126.com
Country: China
ProdList: 19103
Advantage: 58

Zhejiang J&C Biological Technology Co.,Limited

Tel: +1-2135480471 +1-2135480471
Email: sales@sarms4muscle.com
Country: China
ProdList: 10473
Advantage: 58

Hangzhou Go Top Peptide Biotech

Tel: 0571-88211921
Email: sales1@gotopbio.com
Country: CHINA
ProdList: 2609
Advantage: 58

Cellmano Biotech Limited

Tel: 0551-65326643 18156095617
Fax: 0551-65326641
Email: info@cellmano.com
Country: China
ProdList: 995
Advantage: 58

career henan chemical co

Tel: +86-0371-86658258 +8613203830695
Fax: 0086-371-86658258
Email: factory@coreychem.com
Country: China
ProdList: 29810
Advantage: 58

Nanchang Tianzhen Biotechnology Co., Ltd

Tel: 13173652190
Email: pomy@tanzhenbio.com
Country: China
ProdList: 1865
Advantage: 58

Wuxi Helen Biotechnology Co., Ltd.,

Tel: 0510-85629785 18013409632
Fax: 0510-85625359
Email: sales@reading-chemicals.com
Country: China
ProdList: 14081
Advantage: 58

Nanjing TGpeptide Biotechnology Co.,Ltd.

Tel: 18115476705
Email: sales@tgpeptide.com
Country: China
ProdList: 3058
Advantage: 58

Ontores Biotech

Tel: 0571-88760729 18072970094
Email: supports@ontorespeptide.com
Country: China
ProdList: 2696
Advantage: 58

Wuhan Wiseman Bioengineering Co.,Ltd

Tel: 027-59506022 13419526507
Fax: 027-59506022
Email: 13419526507@163.com
Country: China
ProdList: 2981
Advantage: 58

Hangzhou Go Top Peptide Biotech

Tel: 0571-88211921 13735575465
Email: sales1@gotopbio.com
Country: China
ProdList: 2891
Advantage: 58

TCI (Shanghai) Chemical Trading Co., Ltd.

Tel: 021-021-61109150
Fax: 021-61105897
Email: sales@tcisct.com
Country: China
ProdList: 31121
Advantage: 58

Shanghai Universal Biotech Co.,Ltd

Tel: 13774214275
Email: zhouzz@univ-bio.com
Country: China
ProdList: 24997
Advantage: 58

Shangqiu Ladybug Network Technology Co., LTD

Tel: 17550092151
Fax: 03702782809
Email: 3628320093@qq.com
Country: China
ProdList: 4206
Advantage: 58

Nanjing Shizhou Biology Technology Co.,Ltd

Tel: 13675144456
Email: alan.chow@synzest.com
Country: China
ProdList: 9470
Advantage: 58

Nanjing Yuanpeptide Biotech Co.，Ltd.

Tel: 18168071971
Email: support@yuan-peptide.com
Country: China
ProdList: 2978
Advantage: 58

Chengdu Jinglin Biotechnology Co., Ltd.

Tel: 17711399154
Email: 3211919385@qq.com
Country: China
ProdList: 1815
Advantage: 58

Shaoxing Junyu Biotechnology Co., LTD

Tel: 0571-88211921 15572296305
Email: sales4@gotopbio.com
Country: China
ProdList: 5178
Advantage: 58

TargetMol Chemicals Inc.

Tel: 4008200310
Email: marketing@tsbiochem.com
Country: China
ProdList: 24644
Advantage: 58

Hangzhou Sinoda Pharmaceutical Technology Co. LTD

Tel: 0571-87213919 17306812703
Email: 3007955328@qq.com
Country: China
ProdList: 6628
Advantage: 58

Hubei Wanye Zhongcheng Chemical Reagent Co., Ltd.

Tel: 18671296875 18671296875
Email: 1205035102@qq.com
Country: China
ProdList: 4302
Advantage: 58

Shaanxi Cuikang Pharmaceutical Technology Co., Ltd

Tel: 18049165724 13186333400
Email: cuichengbio@163.com
Country: China
ProdList: 3986
Advantage: 58

Hangzhou Baige Pharmaceutical Technology Co. , Ltd.

Tel: 0571-85350119 15888826472
Email: 15888826472@163.com
Country: China
ProdList: 2729
Advantage: 58

Shanghai HongTide Biotechnology Co.,Ltd.

Tel: 19961912513
Email: sales@hongtide.com
Country: China
ProdList: 4604
Advantage: 58

Zhongke Huayao (Jiangsu) Biotechnology Co., Ltd

Tel: 13770887460
Email: wenxi@jszkhy.com
Country: China
ProdList: 1349
Advantage: 58

Combio (Suzhou) Ltd.

Tel: 0512-51886999 17706251929
Email: office@combiosz.com
Country: China
ProdList: 2978
Advantage: 58

https://hanhongsci.com/

Tel: 021-54306202 18917919676
Email: info@hanhongsci.com
Country: China
ProdList: 29979
Advantage: 58

Shanghai Toyang Biotechnology Co., LTD

Tel: 021-59555769 13524932310
Fax: 021-50342869
Email: 1405894150@qq.com
Country: China
ProdList: 8221
Advantage: 58

Zhejiang Jiekun Biotechnology Co., Ltd

Tel: 0571-88211951 13735575465
Email: sales1@gotopbio.com
Country: China
ProdList: 4904
Advantage: 58

Shanghai Zhiyun Biotechnology Co., Ltd

Tel: 13119135307
Email: 3809801531@qq.com
Country: China
ProdList: 2767
Advantage: 58

Taiyuan Bailihengkang Biotechnology Co., Ltd

Tel: 19135651983 19135651983
Email: 18611134419@163.com
Country: China
ProdList: 4416
Advantage: 58

Phygene

Tel: 18059081430
Email: 2070812664@qq.com
Country: China
ProdList: 1232
Advantage: 58

Hangzhou Beiputai Biopharmaceutical Co., Ltd

Tel: 0571-85350119 15888826472
Email: bptsales@163.com
Country: China
ProdList: 3851
Advantage: 58

Hubei wei shi reagent group ltd., company

Tel: 027-02759101766 13125137661
Email: 2853877621@qq.com
Country: China
ProdList: 6138
Advantage: 58

Minglong (Xianning) Pharmaceutical Co., LTD

Tel: 155-7155-6913 15571556913
Email: 354024111@qq.com
Country: China
ProdList: 2619
Advantage: 58

Changsha MOL Changes Biotechnology Co., Ltd.

Tel: +8619375158599
Email: info@molchanges.com
Country: China
ProdList: 5223
Advantage: 58

Shenzhen Nexconn Pharmatechs Ltd

Tel: +86-755-89396905 +86-15013857715
Email: admin@nexconn.com
Country: China
ProdList: 10311
Advantage: 58

Less

View Lastest Price from UROTENSIN II (HUMAN) manufacturers

Career Henan Chemical Co

Product: UROTENSIN II (HUMAN) 251293-28-4
Price: US $7.00/KG
Min. Order: 1KG
Purity: 99%
Supply Ability: 100KG
Release date: 2020-02-16

251293-28-4, UROTENSIN II (HUMAN)Related Search:

UROTENSIN-II Aviptadil UROTENSIN I FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2 STRESSCOPIN (3-40) (HUMAN) TRIFLUOROACETATE SALT urotensin II Uroguanylin Topoisomer B (human) Uroguanylin (human) UROCORTIN (RAT) STRESSCOPIN-RELATED PEPTIDE (6-43) (HUMAN) TRIFLUOROACETATE SALT UROCORTIN (HUMAN) Urotensin II (Frog) Urocortin II (mouse) Urotensin II,mouse TFA URODILATIN HUMAN Urotensin-2B Urocortin III, mouse, free acid Urotensin II (114-124), human TFA

UROTENSIN II (HUMAN) HYDROCHLORIDE

UROTENSIN II (HUMAN)

ETPDCFWKYCV, HCL (DISULFIDE BRIDGE: 5-10)

GLU-THR-PRO-ASP-CYS-PHE-TRP-LYS-TYR-CYS-VAL

GLU-THR-PRO-ASP-CYS-PHE-TRP-LYS-TYR-CYS-VAL HYDROCHLORIDE

Urotensin II human, ≥97% (HPLC)

H-GLU-THR-PRO-ASP-CYS-PHE-TRP-LYS-TYR-CYS-VAL-OH, HCL (DISULFIDE BRIDGE: 5-10)

H-GLU-THR-PRO-ASP-CYS-PHE-TRP-LYS-TYR-CYS-VAL-OH

Urotensin II, human (3)

H-Glu-Thr-Pro-Asp-Cys-Phe-Trp-Lys-Tyr-Cys-Val-OH (Cys5-Cys10)

H-Glu-Thr-Pro-Asp-Cys-Phe-Trp-Lys-Tyr-Cys-Val-OH, (Disulfide bond)

ANTI-UTS2(N-TERMINAL) antibody produced in rabbit

Urotensin-2

UTS2

Ala-Gly-Thr-Ala-Asp-Cys-Phe-Trp-Lys-Tyr-Cys-Val [Disulfide bridge: 6–11]

Urotensin II (114-124), human

M.W. 1388.57 C64H85N13O18S2

L-Ala-Gly-L-Thr-L-Ala-L-Asp-L-Cys-L-Phe-L-Trp-L-Lys-L-Tyr-L-Cys-L-Val-OH

GLU-THR-PRO-ASP-CYS-PHE-TRP-LYS-TYR-CYS-VAL(DISULFIDE BRIDGE:CYS5-CYS10)

U-II (huMan)

L-Valine, L-α-glutamyl-L-threonyl-L-prolyl-L-α-aspartyl-L-cysteinyl-L-phenylalanyl-L-tryptophyl-L-lysyl-L-tyrosyl-L-cysteinyl-, cyclic (5→10)-disulfide

UrotensinII, human Bridge

Urotensin II (human) TFA

251293-28-4

C64H87N13O18S2

C64H85N13O18S2

Peptide

Urotensin receptor