BNP-32 (RAT)
- Product Name
- BNP-32 (RAT)
- CAS No.
- 133448-20-1
- Chemical Name
- BNP-32 (RAT)
- Synonyms
- BNP RAT;BNP-32 (RAT);BNP (1-32) RAT;BNP (51-95), RAT;BNP-32 (rat) trifluoroacetate;NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF;Brain Natriuretic Peptide (1-32);BRAIN NATRIURETIC PEPTIDE-32 (RAT);Rat brain natriuretic peptide(1-32);BRAIN NATRIURETIC PEPTIDE (1-32), RAT
- CBNumber
- CB3403598
- Molecular Formula
- C146H239N47O44S3
- Formula Weight
- 3452.94
- MOL File
- 133448-20-1.mol
BNP-32 (RAT) Property
- Density
- 1.50±0.1 g/cm3(Predicted)
- storage temp.
- -20°C
- form
- powder
- Water Solubility
- Soluble in Water
- Sequence
- Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe (Disulfide bridge: Cys10-Cys26)
- InChIKey
- CKSKSHHAEYGHSB-LBCJMRPYSA-N
Safety
- WGK Germany
- 3
- Storage Class
- 11 - Combustible Solids
N-Bromosuccinimide Price
- Product number
- FB109674
- Product name
- BNP-32 (rat) trifluoroacetate
- Packaging
- 50ug
- Price
- $91
- Updated
- 2021/12/16
- Product number
- CS-0044640
- Product name
- Brain Natriuretic Peptide (1-32), rat
- Packaging
- 500ug
- Price
- $260
- Updated
- 2021/12/16
- Product number
- FB109674
- Product name
- BNP-32 (rat) trifluoroacetate
- Packaging
- 250ug
- Price
- $317.5
- Updated
- 2021/12/16
- Product number
- CS-0044640
- Product name
- Brain Natriuretic Peptide (1-32), rat
- Packaging
- 1mg
- Price
- $390
- Updated
- 2021/12/16
- Product number
- FB109674
- Product name
- BNP-32 (rat) trifluoroacetate
- Packaging
- 500ug
- Price
- $550
- Updated
- 2021/12/16
BNP-32 (RAT) Chemical Properties,Usage,Production
Uses
Brain Natriuretic Peptide (1-32), rat (BNP (1-32), rat) is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes)[1].
Biochem/physiol Actions
Brain natriuretic peptide (type B natriuretic peptide) was originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulation. It is involved in blood pressure control and cardiovascular homeostasis.
in vivo
The depressor, natriuretic and cyclic GMP responses to several species of brain natriuretic peptide (BNP) are compared to atrial natriureticpeptide (ANP) 99-126 in conscious spontaneously hypertensive rats (SHR) and in conscious cynomolgus monkeys treated with vehicle or the selective neutral endopeptidase inhibitor SQ 28603. In the conscious SHR, the natriuretic and cyclic GMP responses to 3 nmol/kg i.v. rat BNP (1-32) greater than rat ANP 99-126 greater than pig BNP-26 and sre significantly potentiated by 100 mumol/kg i.v. SQ 28,603. Human BNP-32 is inactive in the SHR treated with either vehicle or SQ 28,603. In contrast, 1 nmol/kg i.v. of human BNP (1-32) stimulates renal and depressor responses in the conscious monkeys that are greater than or equal to those elicited by human ANP 99-126, whereas 3 nmol/kg i.v. rat BNP (1-32) reduces mean arterial pressure without affecting renal function[3].
References
[1] Dickey DM, et al. Human B-type natriuretic peptide is not degraded by meprin A. Biochem Pharmacol. 2010 Oct 1;80(7):1007-11. DOI:10.1016/j.bcp.2010.06.015
[2] Wellard J, et al. Natriuretic peptides, but not nitric oxide donors, elevate levels of cytosolic guanosine 3',5'-cyclic monophosphate in ependymal cells ex vivo. Neurosci Lett. 2006 Jan 16;392(3):187-92. DOI:10.1016/j.neulet.2005.09.084
[3] Seymour AA, et al. Potentiation of brain natriuretic peptides by SQ 28,603, an inhibitor of neutral endopeptidase3.4.24.11, in monkeys and rats. J Pharmacol Exp Ther. 1992 Jul;262(1):60-70. PMID:1385630
BNP-32 (RAT) Preparation Products And Raw materials
Raw materials
Preparation Products
BNP-32 (RAT) Suppliers
- Tel
- 21-61263452 13641803416
- Fax
- 86-21-61263399
- ymbetter@glbiochem.com
- Country
- China
- ProdList
- 9981
- Advantage
- 64
- Tel
- 021-54306202 13764082696
- info@hanhongsci.com
- Country
- China
- ProdList
- 42934
- Advantage
- 64
- Tel
- 021-50135380
- shchemsky@sina.com
- Country
- China
- ProdList
- 15402
- Advantage
- 60
- Tel
- 0551-65326643 18156095617
- Fax
- 0551-65326641
- info@cellmano.com
- Country
- China
- ProdList
- 1010
- Advantage
- 55
- Tel
- 400-6206333 13167063860
- Fax
- 021-50323701
- anhua.mao@aladdin-e.com
- Country
- China
- ProdList
- 26606
- Advantage
- 65
- Tel
- 0510-85629785 18013409632
- Fax
- 051085625359
- sales@reading-chemicals.com
- Country
- China
- ProdList
- 15178
- Advantage
- 58
- Tel
- 021-61415566 800-8193336
- orderCN@merckgroup.com
- Country
- China
- ProdList
- 51395
- Advantage
- 80
- Tel
- info@creative-peptides.com
- Country
- United States
- ProdList
- 6083
- Advantage
- 56
- Tel
- 18620099427
- Fax
- +86-20-62619665
- amy@howeipharm.com
- Country
- China
- ProdList
- 6687
- Advantage
- 55
- Tel
- 021-52907766-8042
- Fax
- 021-52906523
- Country
- China
- ProdList
- 9941
- Advantage
- 58