Obtustatin

Product Name: Obtustatin
CAS No.: 404882-00-4
Chemical Name: Obtustatin
Synonyms: Obtustatin;CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG(MODIFICATIONS: DISULFIDE BRIDGE: 1-10,6-29,7-34,19-36)
CBNumber: CB43367986
Formula Weight: 0
MOL File: Mol file

More

Less

Obtustatin Property

form: Solid
color: White to off-white
Sequence: Cys-Thr-Thr-Gly-Pro-Cys-Cys-Arg-Gln-Cys-Lys-Leu-Lys-Pro-Ala-Gly-Thr-Thr-Cys-Trp-Lys-Thr-Ser-Leu-Thr-Ser-His-Tyr-Cys-Thr-Gly-Lys-Ser-Cys-Asp-Cys-Pro-Leu-Tyr-Pro-Gly (Disulfide bridge: Cys1-Cys10, Cys6-Cys29, Cys7-Cys34, Cys19-Cys36)

More

Less

Hazard and Precautionary Statements (GHS)

More

Less

N-Bromosuccinimide Price

Tocris

Product number: 4664
Product name: Obtustatin
Packaging: 100U
Price: $331
Updated: 2021/12/16

ApexBio Technology

Product number: B5675
Product name: Obtustatin
Packaging: 100ug
Price: $477
Updated: 2021/12/16

More

Less

Obtustatin Chemical Properties,Usage,Production

Uses

Obtustatin is a non-RGD disintegrin of 41 residues. Obtustatin can be isolated from Vipera lebetina obtusa venom. Obtustatin is a potent and selective inhibitor of the adhesion of integrin α1β1 to collagen IV. Obtustatin inhibits angiogenesis, and can be used for research of cancer[1][2].

Enzyme inhibitor

This 41-residue disintegrin (FW = 4401 g/mol; Sequence CTTGPCCRQ CKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG, with disulfide bonds at Cys1-Cys10, Cys6-Cys29, Cys7-Cys34, and Cys19-Cys36) from the venom of the blunt-nosed viper Vipera lebetina obtusa exhibits tight binding to integrins, inhibiting platelet aggregation, IC50 = 2 nM. It is the shortest polypeptide to contain an integrin-recognition loop. Target(s): Obtustatin is a highly potent integrin α1β1 inhibitor (IC50 = 0.8 nM for α1β1 binding to type IV collagen), displaying specificity for α1β1 over α2β1, αIIbβ3, αvβ3, α4β1, α5β6, α9β1 and α4β7.

References

[1] Paz Moreno-Murciano M, et al. NMR solution structure of the non-RGD disintegrin obtustatin. J Mol Biol. 2003 May 23;329(1):135-45. DOI:10.1016/s0022-2836(03)00371-1
[2] Marcinkiewicz C, et al. Obtustatin: a potent selective inhibitor of alpha1beta1 integrin in vitro and angiogenesis in vivo. Cancer Res. 2003 May 1;63(9):2020-3. PMID:12727812

Obtustatin Preparation Products And Raw materials

Raw materials

Preparation Products

More

Less

Obtustatin Suppliers

China 25 United Kingdom 1 United States 3 Global 29

Wuxi Zhongkun Biochemical Technology Co., Ltd.

Tel: 0510-85629785 18013409632
Fax: 051085625359
Email: sales@reading-chemicals.com
Country: China
ProdList: 15178
Advantage: 58

Hangzhou Peptidego Biotech Co.,Ltd.

Tel: 0571-87213919
Email: Eric@peptidego.com
Country: China
ProdList: 7408
Advantage: 58

Shanghai Longyu Biotechnology Co., Ltd.

Tel: +8619521488211
Fax: +86 15821988213
Email: info@longyupharma.com
Country: China
ProdList: 2541
Advantage: 58

Wuxi Helen Biotechnology Co., Ltd.,

Tel: 0510-85629785 18013409632
Fax: 0510-85625359
Email: sales@reading-chemicals.com
Country: China
ProdList: 14081
Advantage: 58

Nanjing Yuanpeptide Biotech Co.，Ltd.

Tel: 18168071971
Email: support@yuan-peptide.com
Country: China
ProdList: 2983
Advantage: 58

Shaoxing Junyu Biotechnology Co., LTD

Tel: 0571-0571-88211921 19105816207
Email: sales4@gotopbio.com
Country: China
ProdList: 5144
Advantage: 58

Hangzhou Sinoda Pharmaceutical Technology Co. LTD

Tel: 0571-87213919 17306812703
Email: 3007955328@qq.com
Country: China
ProdList: 6979
Advantage: 58

Shanghai HongTide Biotechnology Co.,Ltd.

Tel: 15318089928
Email: alex@hanhonggroup.com
Country: China
ProdList: 4604
Advantage: 58

Zhejiang Jiekun Biotechnology Co., Ltd

Tel: 0571-88211951 13735575465
Email: sales1@gotopbio.com
Country: China
ProdList: 4880
Advantage: 58

R&D Systems, Inc

Tel: 18003437475
Fax: 1-612-656-4400
Email: rdname@qq.com
Country: China
ProdList: 6960
Advantage: 58

Biosynth Biological Technology (Suzhou) Co Ltd

Tel: 51288865780
Email: sales@biosynth.com
Country: China
ProdList: 6051
Advantage: 58

Adooq Bioscience LLC

Tel: 400-025-6535
Email: sales@adooq.cn
Country: China
ProdList: 6215
Advantage: 58

Nanjing Typeptide Biotechnology Co.,Ltd.

Tel: 19941518170
Email: sales@typeptide.com
Country: China
ProdList: 3920
Advantage: 58

Fuan Bio

Tel: 18178976185
Email: 3855357086@qq.com
Country: China
ProdList: 2048
Advantage: 58

Changsha MOL Changes Biotechnology Co., Ltd.

Tel: +8619375158599
Email: info@molchanges.com
Country: China
ProdList: 5218
Advantage: 58

Shanghai Hongmai Biotechnology Co., Ltd.

Tel: 400-920-5774
Country: CHINA
ProdList: 146
Advantage: 58

Henan Bomeisi Trading Co., Ltd.

Tel: 0371-86035915
Country: CHINA
ProdList: 168
Advantage: 58

Beijing Bolide Biotechnology Co., Ltd.

Tel: --
Fax: --
Email: 1985563437@qq.com
Country: CHINA
ProdList: 6525
Advantage: 58

Shanghai Yihui Biotechnology Co., Ltd.

Tel: --
Fax: --
Email: yihbio@163.com
Country: CHINA
ProdList: 6184
Advantage: 58

Beijing Fubo Biotechnology Co., Ltd.

Tel: --
Fax: --
Email: info@f-biology.com
Country: CHINA
ProdList: 6170
Advantage: 58

Shanghai Gantu Biological Technology Co., Ltd.

Tel: --
Fax: --
Email: 1920192055@qq.com
Country: CHINA
ProdList: 1843
Advantage: 58

Shanghai Chaoyan Biotechnology Co., Ltd.

Tel: --
Fax: --
Email: 471161314@qq.com
Country: CHINA
ProdList: 6210
Advantage: 58

Beijing Qunxiao Keyuan Biotechnology Co., Ltd.

Tel: --
Fax: --
Email: mail@qbioscience.com
Country: CHINA
ProdList: 640
Advantage: 58

Shanghai Haoyang Biological Technology Co., Ltd.

Tel: --
Fax: --
Email: 596799915@QQ.COM
Country: CHINA
ProdList: 2905
Advantage: 58

Shanghai Weiwei Biological Technology Co., Ltd.

Tel: --
Fax: --
Email: sales@wheybio.com
Country: CHINA
ProdList: 4398
Advantage: 58

404882-00-4, ObtustatinRelated Search:

H-PHE-ASN-ALA-PRO-PHE-ASP-VAL-GLY-ILE-LYS-LEU-SER-GLY-VAL-GLN-TYR-GLN-GLN-HIS-SER-GLN-ALA-LEU-NH2 Obestatin (Rat, Mouse)

CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG(MODIFICATIONS: DISULFIDE BRIDGE: 1-10,6-29,7-34,19-36)

Obtustatin

404882-00-4