Prolactin Releasing Peptide (12-31), human
- Product Name
- Prolactin Releasing Peptide (12-31), human
- CAS No.
- 235433-36-0
- Chemical Name
- Prolactin Releasing Peptide (12-31), human
- Synonyms
- PRRP20;PRRP31;PRRP20 (HUMAN);PRRP31 (HUMAN);TPDINPAWYASRGIRPVGRF-NH2;PREPROLACTIN (23-53) (HUMAN);PREPROLACTIN (34-53) (HUMAN);PROLACTIN-RELEASING PEPTIDE (1-31);SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2;PROLACTIN-RELEASING PEPTIDE (HUMAN)
- CBNumber
- CB6303439
- Molecular Formula
- C104H158N32O26
- Formula Weight
- 2272.57
- MOL File
- 235433-36-0.mol
Prolactin Releasing Peptide (12-31), human Property
- Density
- 1.50±0.1 g/cm3(Predicted)
- storage temp.
- −20°C
- form
- Solid
- color
- White to off-white
- Sequence
- Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2
Safety
- WGK Germany
- 3
N-Bromosuccinimide Price
- Product number
- 302136
- Product name
- Prolactin-Releasing Peptide-20, Human
- Packaging
- 200ug
- Price
- $439
- Updated
- 2021/12/16
- Product number
- PEP0002953
- Product name
- H-SER-ARG-THR-HIS-ARG-HIS-SER-MET-GLU-ILE-ARG-THR-PRO-ASP-ILE-ASN-PRO-ALA-TRP-TYR-ALA-SER-ARG-GLY-ILE-ARG-PRO-VAL-GLY-ARG-PHE-NH2
- Purity
- 95.00%
- Packaging
- 0.5MG
- Price
- $642.18
- Updated
- 2021/12/16
- Product number
- PEP0002953
- Product name
- H-SER-ARG-THR-HIS-ARG-HIS-SER-MET-GLU-ILE-ARG-THR-PRO-ASP-ILE-ASN-PRO-ALA-TRP-TYR-ALA-SER-ARG-GLY-ILE-ARG-PRO-VAL-GLY-ARG-PHE-NH2
- Purity
- 95.00%
- Packaging
- 1MG
- Price
- $771.31
- Updated
- 2021/12/16
Prolactin Releasing Peptide (12-31), human Chemical Properties,Usage,Production
Uses
Prolactin Releasing Peptide (12-31), human is a fragment of the prolactin releasing peptide (PrRP). Prolactin Releasing Peptide (1-31), human is a high affinity GPR10 ligand that cause the release of the prolactin.
in vivo
Following intracerebroventricular injection of Prolactin Releasing Peptide (1-31), human 5 nM there is a highly significant simulation of plasma LH that began at 10 minutes and is maintained over the course of the experiment. Plasma FSH increased at 20 minutes following ICV injection. Total plasma testosterone increased at 60 minutes post injection[3].
References
[1] Roland BL, et al. Anatomical distribution of prolactin-releasing peptide and its receptor suggests additional functions in the central nervous system and periphery. Endocrinology. 1999 Dec;140(12):5736-45. DOI:10.1210/endo.140.12.7211
[2] Langmead CJ, et al. Characterization of the binding of [(125)I]-human prolactin releasing peptide (PrRP) to GPR10, a novel G protein coupled receptor. Br J Pharmacol. 2000 Oct;131(4):683-8. DOI:10.1038/sj.bjp.0703617
[3] Seal LJ, et al. Prolactin releasing peptide (PrRP) stimulates luteinizing hormone (LH) and follicle stimulating hormone (FSH) via a hypothalamic mechanism in male rats. Endocrinology. 2000 May;141(5):1909-12. DOI:10.1210/endo.141.5.7528
Prolactin Releasing Peptide (12-31), human Preparation Products And Raw materials
Raw materials
Preparation Products
Prolactin Releasing Peptide (12-31), human Suppliers
- Tel
- 21-61263452 13641803416
- Fax
- 86-21-61263399
- ymbetter@glbiochem.com
- Country
- China
- ProdList
- 9981
- Advantage
- 64
- Tel
- 021-54306202 13764082696
- info@hanhongsci.com
- Country
- China
- ProdList
- 42934
- Advantage
- 64
- Tel
- 021-50135380
- shchemsky@sina.com
- Country
- China
- ProdList
- 32321
- Advantage
- 50
- Tel
- 0731-85526065 13308475853
- ivy@hnhbsj.com
- Country
- China
- ProdList
- 7247
- Advantage
- 62
- Tel
- 0551-65326643 18156095617
- Fax
- 0551-65326641
- info@cellmano.com
- Country
- China
- ProdList
- 1010
- Advantage
- 55
- Tel
- info@creative-peptides.com
- Country
- United States
- ProdList
- 6083
- Advantage
- 56
- Tel
- 18620099427
- Fax
- +86-20-62619665
- amy@howeipharm.com
- Country
- China
- ProdList
- 6687
- Advantage
- 55
- Tel
- 010-50973130 18101056239
- 3193328036@qq.com
- Country
- China
- ProdList
- 29760
- Advantage
- 68
- Tel
- 17705183659
- Fax
- 84523390
- sales@njleonbiotech.com
- Country
- China
- ProdList
- 5501
- Advantage
- 55
- Tel
- 025-58361106-805 15951641583
- Fax
- 025-58361106-806
- zhao.xu@njpeptide.com
- Country
- China
- ProdList
- 9979
- Advantage
- 55