(D-Ala2)-Gastric Inhibitory Polypeptide (human)

Product Name: (D-Ala2)-Gastric Inhibitory Polypeptide (human)
CAS No.: 444073-04-5
Chemical Name: (D-Ala2)-Gastric Inhibitory Polypeptide (human)
Synonyms: [D-Ala2]-GIP (human);Y（D-A）EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ;(D-Ala2)-Gastric Inhibitory Polypeptide (human);(D-Ala2)-Gastric Inhibitory Polypeptide (human) TFA;(D-Ala?)-Gastric Inhibitory Polypeptide (human) trifluoroacetate salt
CBNumber: CB63864308
Molecular Formula: C22H27NO11
Formula Weight: 481.44988
MOL File: 444073-04-5.mol

More

Less

(D-Ala2)-Gastric Inhibitory Polypeptide (human) Property

storage temp.: Store at -20°C
solubility: Soluble in DMSO
form: Solid
color: White to off-white
Water Solubility: Soluble to 1 mg/ml in water

More

Less

Hazard and Precautionary Statements (GHS)

More

Less

N-Bromosuccinimide Price

Tocris

Product number: 6699
Product name: [D-Ala2]-GIP(human)
Packaging: 1
Price: $381
Updated: 2021/12/16

More

Less

(D-Ala2)-Gastric Inhibitory Polypeptide (human) Chemical Properties,Usage,Production

Uses

[D-Ala2]-GIP (human) is a GIP receptor agonist. [D-Ala2]-GIP (human) improves glucose tolerance. [D-Ala2]-GIP (human) shows neuroprotective activity in MPTP-induced Parkinson's disease model. [D-Ala2]-GIP (human) also improves cognitive function and hippocampal synaptic plasticity in obese diabetic rats. [D-Ala2]-GIP (human) can be used for research of type 2 diabetes, Parkinson's disease, etc[1]

storage

Store at -20°C

References

[1] Hinke SA, et al. Dipeptidyl peptidase IV-resistant [D-Ala(2)]glucose-dependent insulinotropic polypeptide (GIP) improves glucose tolerance in normal and obese diabetic rats. Diabetes. 2002 Mar;51(3):652-61. DOI:10.2337/diabetes.51.3.652
[2] Porter DW,et al. Prolonged GIP receptor activation improves cognitive function, hippocampal synaptic plasticity and glucose homeostasis in high-fat fed mice. Eur J Pharmacol. 2011 Jan 15;650(2-3):688-93. DOI:10.1016/j.ejphar.2010.10.059
[3] Verma MK, et al. Effect of D-Ala2GIP, a stable GIP receptor agonist on MPTP-induced neuronal impairments in mice. Eur J Pharmacol. 2017 Jun 5;804:38-45. DOI:10.1016/j.ejphar.2017.03.059

(D-Ala2)-Gastric Inhibitory Polypeptide (human) Preparation Products And Raw materials

Raw materials

Preparation Products

More

Less

(D-Ala2)-Gastric Inhibitory Polypeptide (human) Suppliers

China 27 Switzerland 1 United Kingdom 1 United States 2 Global 31

Chengdu Youngshe Chemical Co., Ltd.

Tel: +86-17380623303
Fax: 028-62328193
Email: Caroline@youngshechem.com
Country: China
ProdList: 4802
Advantage: 58

Hangzhou Peptidego Biotech Co.,Ltd.

Tel: 0571-87213919
Email: Eric@peptidego.com
Country: China
ProdList: 7408
Advantage: 58

Career Henan Chemica Co

Tel: +86-0371-86658258 +8613203830695
Fax: 0371-86658258
Email: laboratory@coreychem.com
Country: China
ProdList: 30229
Advantage: 58

Nanchang Tianzhen Biotechnology Co., Ltd

Tel: 13758194781 13173652190
Email: 522013271@qq.com
Country: China
ProdList: 2395
Advantage: 58

Nanjing TGpeptide Biotechnology Co.,Ltd.

Tel: 18115476705
Email: sales@tgpeptide.com
Country: China
ProdList: 3058
Advantage: 58

Hangzhou Go Top Peptide Biotech

Tel: 15397062932
Email: sales1@gotopbio.com
Country: China
ProdList: 2923
Advantage: 58

Shaoxing Junyu Biotechnology Co., LTD

Tel: 0571-0571-88211921 19105816207
Email: sales4@gotopbio.com
Country: China
ProdList: 5144
Advantage: 58

TargetMol Chemicals Inc.

Tel: 4008200310
Email: marketing@tsbiochem.com
Country: China
ProdList: 24961
Advantage: 58

Hangzhou Sinoda Pharmaceutical Technology Co. LTD

Tel: 0571-87213919 17306812703
Email: 3007955328@qq.com
Country: China
ProdList: 6979
Advantage: 58

Hangzhou Baige Pharmaceutical Technology Co. , Ltd.

Tel: 0571-85350119 15888826472
Email: 15888826472@163.com
Country: China
ProdList: 2729
Advantage: 58

Shanghai HongTide Biotechnology Co.,Ltd.

Tel: 15318089928
Email: alex@hanhonggroup.com
Country: China
ProdList: 4604
Advantage: 58

Combio (Suzhou) Ltd.

Tel: 17751201929
Email: office@combiosz.com
Country: China
ProdList: 3000
Advantage: 58

https://hanhongsci.com/

Tel: 021-54306202 18917919676
Email: info@hanhongsci.com
Country: China
ProdList: 29995
Advantage: 58

Zhejiang Jiekun Biotechnology Co., Ltd

Tel: 0571-88211951 13735575465
Email: sales1@gotopbio.com
Country: China
ProdList: 4880
Advantage: 58

Taiyuan Bailihengkang Biotechnology Co., Ltd

Tel: 19135651983
Email: 18611134419@163.com
Country: China
ProdList: 4416
Advantage: 58

Hangzhou Beiputai Biopharmaceutical Co., Ltd

Tel: 0571-85350119 15888826472
Email: bptsales@163.com
Country: China
ProdList: 3834
Advantage: 58

R&D Systems, Inc

Tel: 18003437475
Fax: 1-612-656-4400
Email: rdname@qq.com
Country: China
ProdList: 6960
Advantage: 58

Biosynth Biological Technology (Suzhou) Co Ltd

Tel: 51288865780
Email: sales@biosynth.com
Country: China
ProdList: 6051
Advantage: 58

Adooq Bioscience LLC

Tel: 400-025-6535
Email: sales@adooq.cn
Country: China
ProdList: 6215
Advantage: 58

Nanjing Typeptide Biotechnology Co.,Ltd.

Tel: 19941518170
Email: sales@typeptide.com
Country: China
ProdList: 3920
Advantage: 58

Hangzhou ALLPEPTIDE Biotechnology Co., Ltd.

Tel: 17342063383
Email: sales@allpeptide.com
Country: China
ProdList: 5320
Advantage: 58

YantaiBio

Tel: 13758194781 15083780366
Email: wudegui@tanzhenbio.com
Country: China
ProdList: 1591
Advantage: 58

Fuan Bio

Tel: 18178976185
Email: 3855357086@qq.com
Country: China
ProdList: 2061
Advantage: 58

Changsha MOL Changes Biotechnology Co., Ltd.

Tel: +8619375158599
Email: info@molchanges.com
Country: China
ProdList: 5218
Advantage: 58

Shenzhen Nexconn Pharmatechs Ltd

Tel: +86-755-89396905 +86-15013857715
Email: admin@nexconn.com
Country: China
ProdList: 10405
Advantage: 58

Nanjing TGpeptide

Tel: +86-13347807150
Email: support@tgpeptide.com
Country: China
ProdList: 3279
Advantage: 58

Guangzhou Junuo Biotechnology Co., Ltd.

Tel: 13432975901
Country: CHINA
ProdList: 132
Advantage: 58

444073-04-5, (D-Ala2)-Gastric Inhibitory Polypeptide (human)Related Search:

Dipeptide-8 Cortistatin-29 (human) OLIGOPEPTIDE-2 PL017 Spexin Decapeptide-21 β-Amyloid (7-22) Myristoyl Tirpeptide-4 Z-Val-Leu-Arg-4MβNA · HCl Decapeptide-26

(D-Ala2)-Gastric Inhibitory Polypeptide (human)

[D-Ala2]-GIP (human)

(D-Ala?)-Gastric Inhibitory Polypeptide (human) trifluoroacetate salt

Y（D-A）EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

(D-Ala2)-Gastric Inhibitory Polypeptide (human) TFA

444073-04-5