(D-Ala2)-Gastric Inhibitory Polypeptide (human)
- Product Name
- (D-Ala2)-Gastric Inhibitory Polypeptide (human)
- CAS No.
- 444073-04-5
- Chemical Name
- (D-Ala2)-Gastric Inhibitory Polypeptide (human)
- Synonyms
- [D-Ala2]-GIP (human);Y(D-A)EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ;(D-Ala2)-Gastric Inhibitory Polypeptide (human);(D-Ala2)-Gastric Inhibitory Polypeptide (human) TFA;(D-Ala?)-Gastric Inhibitory Polypeptide (human) trifluoroacetate salt
- CBNumber
- CB63864308
- Molecular Formula
- C22H27NO11
- Formula Weight
- 481.44988
- MOL File
- 444073-04-5.mol
(D-Ala2)-Gastric Inhibitory Polypeptide (human) Property
- storage temp.
- Store at -20°C
- solubility
- Soluble in DMSO
- form
- Solid
- color
- White to off-white
- Water Solubility
- Soluble to 1 mg/ml in water
N-Bromosuccinimide Price
- Product number
- 6699
- Product name
- [D-Ala2]-GIP(human)
- Packaging
- 1
- Price
- $381
- Updated
- 2021/12/16
(D-Ala2)-Gastric Inhibitory Polypeptide (human) Chemical Properties,Usage,Production
Uses
[D-Ala2]-GIP (human) is a GIP receptor agonist. [D-Ala2]-GIP (human) improves glucose tolerance. [D-Ala2]-GIP (human) shows neuroprotective activity in MPTP-induced Parkinson's disease model. [D-Ala2]-GIP (human) also improves cognitive function and hippocampal synaptic plasticity in obese diabetic rats. [D-Ala2]-GIP (human) can be used for research of type 2 diabetes, Parkinson's disease, etc[1]
storage
Store at -20°C
References
[1] Hinke SA, et al. Dipeptidyl peptidase IV-resistant [D-Ala(2)]glucose-dependent insulinotropic polypeptide (GIP) improves glucose tolerance in normal and obese diabetic rats. Diabetes. 2002 Mar;51(3):652-61. DOI:10.2337/diabetes.51.3.652
[2] Porter DW,et al. Prolonged GIP receptor activation improves cognitive function, hippocampal synaptic plasticity and glucose homeostasis in high-fat fed mice. Eur J Pharmacol. 2011 Jan 15;650(2-3):688-93. DOI:10.1016/j.ejphar.2010.10.059
[3] Verma MK, et al. Effect of D-Ala2GIP, a stable GIP receptor agonist on MPTP-induced neuronal impairments in mice. Eur J Pharmacol. 2017 Jun 5;804:38-45. DOI:10.1016/j.ejphar.2017.03.059
(D-Ala2)-Gastric Inhibitory Polypeptide (human) Preparation Products And Raw materials
Raw materials
Preparation Products
(D-Ala2)-Gastric Inhibitory Polypeptide (human) Suppliers
- Tel
- 1-631-485-4226; 16314854226
- info@bocsci.com
- Country
- United States
- ProdList
- 12952
- Advantage
- 65
- Tel
- +86-17380623303
- Fax
- 028-62328193
- Caroline@youngshechem.com
- Country
- China
- ProdList
- 4802
- Advantage
- 58
- Tel
- 0571-87213919
- Eric@peptidego.com
- Country
- China
- ProdList
- 7408
- Advantage
- 58
- Tel
- +86-0371-86658258 +8613203830695
- Fax
- 0371-86658258
- laboratory@coreychem.com
- Country
- China
- ProdList
- 30229
- Advantage
- 58
- Tel
- 13758194781 13173652190
- 522013271@qq.com
- Country
- China
- ProdList
- 2395
- Advantage
- 58
- Tel
- 18115476705
- sales@tgpeptide.com
- Country
- China
- ProdList
- 3058
- Advantage
- 58
- Tel
- 15397062932
- sales1@gotopbio.com
- Country
- China
- ProdList
- 2924
- Advantage
- 58
- Tel
- 0571-0571-88211921 19105816207
- sales4@gotopbio.com
- Country
- China
- ProdList
- 5144
- Advantage
- 58
- Tel
- 4008200310
- marketing@tsbiochem.com
- Country
- China
- ProdList
- 24961
- Advantage
- 58
- Tel
- 0571-87213919 17306812703
- 3007955328@qq.com
- Country
- China
- ProdList
- 6979
- Advantage
- 58