Parstatin (human)
- Product Name
- Parstatin (human)
- CAS No.
- 1065755-99-8
- Chemical Name
- Parstatin (human)
- Synonyms
- Parstatin (human);Parstatin (human) TFA;MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR
- CBNumber
- CB32518777
- Molecular Formula
- C191H330N64O53S3
- Formula Weight
- 0
- MOL File
- Mol file
Parstatin (human) Property
- storage temp.
- Store at -20°C
- form
- Powder
- Water Solubility
- Soluble to 1 mg/ml in water
N-Bromosuccinimide Price
- Product number
- 3553
- Product name
- Parstatin(human)
- Packaging
- 1
- Price
- $352
- Updated
- 2021/12/16
- Product number
- PEP0004614
- Product name
- PARSTATIN-HUMAN
- Purity
- 95.00%
- Packaging
- 5MG
- Price
- $504.42
- Updated
- 2021/12/16
- Product number
- B5450
- Product name
- Parstatin(human)
- Packaging
- 1mg
- Price
- $692
- Updated
- 2021/12/16
Parstatin (human) Chemical Properties,Usage,Production
Description
Cell-permeable peptide cleaved from protease-activated receptor 1 (PAR1) upon receptor activation. Attenuates endothelial cell migration and proliferation (IC50~ 3μM), and induces cell cycle arrest. Promotes activation of caspase-3 and exhibits pro-apoptotic activityin vitro. Inhibits angiogenesis and exhibits cardioprotective activityin vivo.
Uses
Parstatin(human), a cell-penetrating PAR-1 thrombin receptor agonist peptide, is a potent inhibitor of angiogenesis[1][2].
in vivo
Parstatin (single dose, 1-25 μg/kg, iv) administered prior to ischaemia confers immediate cardioprotection by recruiting the Gi-protein activation pathway including p38 MAPK, ERK1/2, NOS, and KATP channels. Parstatin exerts effects on both the cardiomyocytes and the coronary circulation to induce cardioprotection. This suggests a potential therapeutic role of parstatin in the treatment of cardiac injury resulting from ischaemia and reperfusion[1].
| Animal Model: | Male Sprague–Dawley rats at 8 weeks of age (250-300 g)[1]. |
| Dosage: | 1-25 μg/kg. |
| Administration: | IV injected 15 min prior to ischaemia. |
| Result: | A significant decrease in infarct size was detected with the 5-15 μg/kg doses with 10 μg/kg as the optimal dose. These hearts had an infarct size of 46 ± 3% of the area at risk, which is a 26% reduction in infarct size compared with the control. |
References
[1] Panagiota Zania, et al. Parstatin, the Cleaved Peptide on Proteinase-Activated Receptor 1 Activation, Is a Potent Inhibitor of Angiogenesis. J Pharmacol Exp Ther. 2009 Feb;328(2):378-89. DOI:10.1124/jpet.108.145664
[2] Jennifer L Strande, et al. Parstatin: A Cryptic Peptide Involved in Cardioprotection After Ischaemia and Reperfusion Injury. Cardiovasc Res. 2009 Jul 15;83(2):325-34. DOI:10.1093/cvr/cvp122
Parstatin (human) Preparation Products And Raw materials
Raw materials
Preparation Products
Parstatin (human) Suppliers
- Tel
- 821-50328103-801 18930552037
- Fax
- 86-21-50328109
- 3bsc@sina.com
- Country
- China
- ProdList
- 15838
- Advantage
- 69
- Tel
- info@creative-peptides.com
- Country
- United States
- ProdList
- 6083
- Advantage
- 56
- Tel
- +86-17380623303
- Fax
- 028-62328193
- Caroline@youngshechem.com
- Country
- China
- ProdList
- 4802
- Advantage
- 58
- Tel
- 0571-87213919
- Eric@peptidego.com
- Country
- China
- ProdList
- 7408
- Advantage
- 58
- Tel
- 16314854226; +16314854226
- inquiry@bocsci.com
- Country
- United States
- ProdList
- 19654
- Advantage
- 58
- Tel
- 021-61263455 13167021076
- amy@glschina.com
- Country
- China
- ProdList
- 9736
- Advantage
- 58
- Tel
- 15397062932
- sales1@gotopbio.com
- Country
- China
- ProdList
- 2923
- Advantage
- 58
- Tel
- 0571-0571-88211921 19105816207
- sales4@gotopbio.com
- Country
- China
- ProdList
- 5144
- Advantage
- 58
- Tel
- 0571-87213919 17306812703
- 3007955328@qq.com
- Country
- China
- ProdList
- 6979
- Advantage
- 58
- Tel
- 0571-85350119 15888826472
- 15888826472@163.com
- Country
- China
- ProdList
- 2729
- Advantage
- 58