APELIN-36 (HUMAN)

ChemicalBook > CAS DataBase List > APELIN-36 (HUMAN)

Product Name: APELIN-36 (HUMAN)
CAS No.: 252642-12-9
Chemical Name: APELIN-36 (HUMAN)
Synonyms: Apelin (human);APELIN-36 (HUMAN);Apelin-36|Apelin(human);Apelin 36 (human) TFA salt;M.W. 4195.83 C184H297N69O43S;LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF;LEU-VAL-GLN-PRO-ARG-GLY-SER-ARG-ASN-GLY-PRO-GLY-PRO-TRP-GLN-GLY-GLY-ARG-ARG-LYS-PHE-ARG-ARG-GLN-ARG-PRO-ARG-LEU-SER-HIS-LYS-GLY-PRO-MET-PRO-PHE;H-LEU-VAL-GLN-PRO-ARG-GLY-SER-ARG-ASN-GLY-PRO-GLY-PRO-TRP-GLN-GLY-GLY-ARG-ARG-LYS-PHE-ARG-ARG-GLN-ARG-PRO-ARG-LEU-SER-HIS-LYS-GLY-PRO-MET-PRO-PHE-OH;Apelin-36 (human) H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH;L-Leucyl-L-valyl-L-glutaminyl-L-prolyl-L-arginylglycyl-L-seryl-L-arginyl-L-asparaginylglycyl-L-prolylglycyl-L-prolyl-L-tryptophyl-L-glutaminylglycylglycyl-L-arginyl-L-arginyl-L-lysyl-L-phenylalanyl-L-arginyl-L-arginyl-L-glutaminyl-L-arginyl-L-prolyl-L-arginyl-L-leucyl-L-seryl-L-histidyl-L-lysylglycyl-L-prolyl-L-methionyl-L-prolyl-L-phenylalanine
CBNumber: CB1688041
Molecular Formula: C184H295N69O42R2S
Formula Weight: 4177.8132
MOL File: 252642-12-9.mol

Less

APELIN-36 (HUMAN) Property

storage temp.: -15°C
solubility: DMF: 30 mg/ml; DMSO: 30 mg/ml; Ethanol: 10 mg/ml; PBS (pH 7.2): 10 mg/ml
form: Lyophilized powder
Water Solubility: Soluble in water at 1mg/ml

Less

Hazard and Precautionary Statements (GHS)

Less

N-Bromosuccinimide Price

Alfa Aesar

Product number: J66238
Product name: Apelin-36, human
Packaging: 1mg
Price: $238
Updated: 2021/12/16

Alfa Aesar

Product number: J66238
Product name: Apelin-36, human
Packaging: 5mg
Price: $542
Updated: 2021/12/16

Cayman Chemical

Product number: 13524
Product name: Apelin-36
Purity: ≥95%
Packaging: 500μg
Price: $199
Updated: 2024/03/01

Cayman Chemical

Product number: 13524
Product name: Apelin-36
Purity: ≥95%
Packaging: 1mg
Price: $378
Updated: 2024/03/01

Cayman Chemical

Product number: 13524
Product name: Apelin-36
Purity: ≥95%
Packaging: 5mg
Price: $1583
Updated: 2024/03/01

Less

APELIN-36 (HUMAN) Chemical Properties,Usage,Production

storage

Store at -20°C

APELIN-36 (HUMAN) Preparation Products And Raw materials

Raw materials

Preparation Products

Less

APELIN-36 (HUMAN) Suppliers

China 58 France 1 Germany 2 Japan 2 United Kingdom 2 United States 7 USA 1 Global 73

3B Pharmachem (Wuhan) International Co.,Ltd.

Tel: 821-50328103-801 18930552037
Fax: 86-21-50328109
Email: 3bsc@sina.com
Country: China
ProdList: 15848
Advantage: 69

GL Biochem (Shanghai) Ltd

Tel: 21-61263452 13641803416
Fax: 86-21-61263399
Email: ymbetter@glbiochem.com
Country: China
ProdList: 9981
Advantage: 64

Nanjing Chemlin Chemical Co., Ltd

Tel: 025-83697070
Fax: +86-25-83453306
Email: info@chemlin.com.cn
Country: China
ProdList: 18088
Advantage: 64

Shanghai Hanhong Scientific Co.,Ltd.

Tel: 021-021-64543801 13764082696
Email: 2355241799@qq.com
Country: China
ProdList: 42982
Advantage: 64

Chemsky（shanghai）International Co.,Ltd.

Tel: 021-50135380
Email: shchemsky@sina.com
Country: China
ProdList: 32344
Advantage: 50

Cellmano Biotech Limited

Tel: 0551-65326643 18156095617
Fax: 0551-65326641
Email: info@cellmano.com
Country: China
ProdList: 1011
Advantage: 55

Wuxi Zhongkun Biochemical Technology Co., Ltd.

Tel: 0510-85629785 18013409632
Fax: 051085625359
Email: sales@reading-chemicals.com
Country: China
ProdList: 15185
Advantage: 58

Nanjing Leon Biological Technology Co., Ltd.

Tel: 17705183659
Fax: 84523390
Email: sales@njleonbiotech.com
Country: China
ProdList: 5503
Advantage: 55

Nanjing Peptide Biotech Ltd.

Tel: 025-025-58361106-805-805 13082558573
Fax: 025-58361106-806
Email: liugang@njpeptide.com
Country: China
ProdList: 9962
Advantage: 55

Hangzhou Peptidego Biotech Co.,Ltd.

Tel: 0571-87213919
Fax: 0571-87213919
Email: eric@peptidego.com
Country: China
ProdList: 6347
Advantage: 58

Nanjing Meihao Pharmaceutical Technology Co., Ltd.

Tel: meitaochem@126.com
Email: meitaochem@126.com
Country: China
ProdList: 19105
Advantage: 58

Hangzhou Go Top Peptide Biotech

Tel: 0571-88211921
Email: sales1@gotopbio.com
Country: CHINA
ProdList: 2609
Advantage: 58

Cellmano Biotech Limited

Tel: 0551-65326643 18156095617
Fax: 0551-65326641
Email: info@cellmano.com
Country: China
ProdList: 999
Advantage: 58

career henan chemical co

Tel: +86-0371-86658258 15093356674;
Fax: 0086-371-86658258
Email: factory@coreychem.com
Country: China
ProdList: 29826
Advantage: 58

Nanjing chengqimei Biotechnology Co., Ltd

Tel: 19850819832
Email: 2173594524@qq.com
Country: China
ProdList: 2638
Advantage: 58

Gill polypeptide biopharmaceutical (dalian) co., LTD

Tel: 021-61263455 13167021076
Email: amy@glschina.com
Country: China
ProdList: 8217
Advantage: 58

Wuxi Helen Biotechnology Co., Ltd.,

Tel: 0510-85629785 18013409632
Fax: 0510-85625359
Email: sales@reading-chemicals.com
Country: China
ProdList: 14092
Advantage: 58

Nanjing TGpeptide Biotechnology Co.,Ltd.

Tel: 18115476705
Email: sales@tgpeptide.com
Country: China
ProdList: 3189
Advantage: 58

Hangzhou Go Top Peptide Biotech

Tel: 0571-88211921 13355716090
Email: Sales@gotopbio.com
Country: China
ProdList: 2832
Advantage: 58

TCI (Shanghai) Chemical Trading Co., Ltd.

Tel: 021-61109150
Fax: 021-61105897
Email: sales@tcisct.com
Country: China
ProdList: 31163
Advantage: 58

Nanjing Shizhou Biology Technology Co.,Ltd

Tel: 13675144456
Email: alan.chow@synzest.com
Country: China
ProdList: 9471
Advantage: 58

Nanjing Yuanpeptide Biotech Co.，Ltd.

Tel: 18168071971
Email: support@yuan-peptide.com
Country: China
ProdList: 2977
Advantage: 58

Chengdu Jinglin Biotechnology Co., Ltd.

Tel: 17711399154
Email: 3211919385@qq.com
Country: China
ProdList: 1815
Advantage: 58

Shaoxing Junyu Biotechnology Co., LTD

Tel: 0571-88211921 15572296305
Email: sales4@gotopbio.com
Country: China
ProdList: 5144
Advantage: 58

Hangzhou Sinoda Pharmaceutical Technology Co. LTD

Tel: 0571-87213919 17306812703
Email: 3007955328@qq.com
Country: China
ProdList: 5950
Advantage: 58

Hangzhou Baige Pharmaceutical Technology Co. , Ltd.

Tel: 0571-85350119 15888826472
Email: 15888826472@163.com
Country: China
ProdList: 2729
Advantage: 58

Shanghai HongTide Biotechnology Co.,Ltd.

Tel: 19961912513
Email: sales@hongtide.com
Country: China
ProdList: 4560
Advantage: 58

Combio (Suzhou) Ltd.

Tel: 0512-51886999 17706251929
Email: office@combiosz.com
Country: China
ProdList: 2223
Advantage: 58

Shanghai Yifei Biotechnology Co. , Ltd.

Tel: 021-65675885 18964387627
Email: customer_service@efebio.com
Country: China
ProdList: 8740
Advantage: 58

https://hanhongsci.com/

Tel: 021-54306202 18917919676
Email: info@hanhongsci.com
Country: China
ProdList: 29989
Advantage: 58

Shanghai Toyang Biotechnology Co., LTD

Tel: 021-59555769 13524932310
Fax: 021-50342869
Email: 1405894150@qq.com
Country: China
ProdList: 8221
Advantage: 58

Nanjing Yushengkang Biotechnology Co., Ltd

Tel: 13327808530
Email: 2670965693@qq.com
Country: China
ProdList: 2179
Advantage: 58

Zhejiang Jiekun Biotechnology Co., Ltd

Tel: 0571-88211951 13735575465
Email: sales1@gotopbio.com
Country: China
ProdList: 4904
Advantage: 58

Wuhan Peptide Core Biotechnology Co., Ltd

Tel: 027-65317797 13667154760
Email: 1096814016@qq.com
Country: China
ProdList: 9934
Advantage: 58

Taiyuan Bailihengkang Biotechnology Co., Ltd

Tel: 19135651983 19135651983
Email: 18611134419@163.com
Country: China
ProdList: 4977
Advantage: 58

Phygene

Tel: 18059081430
Email: 2070812664@qq.com
Country: China
ProdList: 1232
Advantage: 58

Hangzhou Beiputai Biopharmaceutical Co., Ltd

Tel: 0571-85350119 13305819357
Email: bptsales@163.com
Country: China
ProdList: 3610
Advantage: 58

RD International Technology Co., Limited

Tel: 18024082417
Email: market@ubiochem.com
Country: China
ProdList: 9180
Advantage: 58

TargetMol Chemicals Inc.

Tel: 15002134094
Email: marketing@targetmol.com
Country: China
ProdList: 24246
Advantage: 58

Shenzhen Nexconn Pharmatechs Ltd

Tel: +86-755-89396905 +86-15013857715
Email: admin@nexconn.com
Country: China
ProdList: 10247
Advantage: 58

Nanjing TGpeptide

Tel: +86-13347807150 +86-13347807150
Email: support@tgpeptide.com
Country: China
ProdList: 3279
Advantage: 58

Chengdu Youngshe Chemical Co., Ltd.

Tel: +8618108235634
Email: Cecilia@youngshechem.com
Country: China
ProdList: 2345
Advantage: 58

Guangzhou Weijia Technology Co., Ltd.

Tel: --
Fax: --
Email: WHIGA22@126.COM
Country: CHINA
ProdList: 6748
Advantage: 58

Cohesion Biosciences Limited

Tel: --
Fax: --
Email: custom@cohesionbio.com
Country: CHINA
ProdList: 5350
Advantage: 58

Shenzhen Haodi Huatuo Biotechnology Co., Ltd.

Tel: --
Fax: --
Email: lm0210@otwobiotech.com
Country: CHINA
ProdList: 6435
Advantage: 58

Absin Bioscience Inc.

Tel: --
Fax: --
Email: chenjw@absin.cn
Country: CHINA
ProdList: 6661
Advantage: 58

Beijing Fubo Biotechnology Co., Ltd.

Tel: --
Fax: --
Email: info@f-biology.com
Country: CHINA
ProdList: 6039
Advantage: 58

Shanghai Gaochuang Chemical Technology Co., Ltd.

Tel: --
Fax: --
Email: gaochem@163.com
Country: CHINA
ProdList: 6995
Advantage: 58

Shanghai Hao Zhun Biological Technology Co., Ltd.

Tel: --
Fax: --
Email: info@zzsrm.com
Country: CHINA
ProdList: 6846
Advantage: 58

Beijing Dongge Boye Biotechnology Co., Ltd.

Tel: --
Fax: --
Email: 1861586486@qq.com
Country: CHINA
ProdList: 6652
Advantage: 58

Less

View Lastest Price from APELIN-36 (HUMAN) manufacturers

Career Henan Chemical Co

Product: APELIN-36 (HUMAN) 252642-12-9
Price: US $7.00/KG
Min. Order: 1KG
Purity: 99%
Supply Ability: 100KG
Release date: 2020-02-16

252642-12-9, APELIN-36 (HUMAN)Related Search:

spinorphin GALANIN, HUMAN Orexin B, human TFA hIRBP651-670 DICHLORO(ETHYLENEDIAMINE)PLATINUM(II) METHYL ISOCYANOACETATE 2,4-PENTANEDIONE, SILVER DERIVATIVE Benzyl isocyanide COBALT(II) ACETYLACETONATE TRIS(2,2,6,6-TETRAMETHYL-3,5-HEPTANEDIONATO)DYSPROSIUM(III) Tris(2,4-pentanedionato)chroMiuM(III) PHENYLSELENOL N-BUTYLISOCYANIDE SALCOMINE 1,1,3,3-TETRAMETHYLBUTYL ISOCYANIDE TRIS(2,2,6,6-TETRAMETHYL-3,5-HEPTANEDIONATO)EUROPIUM(III) TERT-BUTYL ISOCYANIDE Ferric acetylacetonate

M.W. 4195.83 C184H297N69O43S

Apelin-36 (human) H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH

L-Leucyl-L-valyl-L-glutaminyl-L-prolyl-L-arginylglycyl-L-seryl-L-arginyl-L-asparaginylglycyl-L-prolylglycyl-L-prolyl-L-tryptophyl-L-glutaminylglycylglycyl-L-arginyl-L-arginyl-L-lysyl-L-phenylalanyl-L-arginyl-L-arginyl-L-glutaminyl-L-arginyl-L-prolyl-L-arginyl-L-leucyl-L-seryl-L-histidyl-L-lysylglycyl-L-prolyl-L-methionyl-L-prolyl-L-phenylalanine

Apelin (human)

LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF

H-LEU-VAL-GLN-PRO-ARG-GLY-SER-ARG-ASN-GLY-PRO-GLY-PRO-TRP-GLN-GLY-GLY-ARG-ARG-LYS-PHE-ARG-ARG-GLN-ARG-PRO-ARG-LEU-SER-HIS-LYS-GLY-PRO-MET-PRO-PHE-OH

LEU-VAL-GLN-PRO-ARG-GLY-SER-ARG-ASN-GLY-PRO-GLY-PRO-TRP-GLN-GLY-GLY-ARG-ARG-LYS-PHE-ARG-ARG-GLN-ARG-PRO-ARG-LEU-SER-HIS-LYS-GLY-PRO-MET-PRO-PHE

APELIN-36 (HUMAN)

Apelin-36|Apelin(human)

Apelin 36 (human) TFA salt

252642-12-9

C184H297N69O43S

peptide

Apelin receptor