Application in Particular Diseases
ChemicalBook > CAS DataBase List > Teriparatide acetate

Teriparatide acetate

Application in Particular Diseases
Product Name
Teriparatide acetate
CAS No.
52232-67-4
Chemical Name
Teriparatide acetate
Synonyms
hPTH (1-34);TERIPARATIDE;Teroparatide;CNV-38d(1-34);Teriparatide CRS;PTH (HUMAN, 1-34);PTH (1-34) (HUMAN);Parathormone (1-34);Teriparatide acetate;Teriparatide (Forteo)
CBNumber
CB2284468
Molecular Formula
C172H278N52O47S2
Formula Weight
3890.49792
MOL File
52232-67-4.mol
More
Less

Teriparatide acetate Property

RTECS 
SQ7770000
storage temp. 
−20°C
form 
powder
CAS DataBase Reference
52232-67-4(CAS DataBase Reference)
More
Less

Safety

WGK Germany 
3
HS Code 
2937190000
Hazardous Substances Data
52232-67-4(Hazardous Substances Data)
More
Less

Hazard and Precautionary Statements (GHS)

More
Less

N-Bromosuccinimide Price

Sigma-Aldrich
Product number
P3796
Product name
Parathyroid Hormone Fragment 1-34 human
Purity
≥95% (HPLC), powder
Packaging
0.1 mg
Price
$143
Updated
2021/12/16
Sigma-Aldrich
Product number
P3796
Product name
Parathyroid Hormone Fragment 1-34 human
Purity
≥95% (HPLC), powder
Packaging
0.5 mg
Price
$220
Updated
2021/12/16
Sigma-Aldrich
Product number
05-23-5501
Product name
Parathyroid Hormone 1-34, Human - CAS 52232-67-4 - Calbiochem
Purity
N-terminal active peptide fragment of the native hormone that functions as a regulatory factor in the homeostatic control of Ca2+ and phosphate metabolism.
Packaging
1 mg
Price
$322.82
Updated
2021/12/16
Sigma-Aldrich
Product number
05-23-5501
Product name
Parathyroid Hormone 1-34, Human
Packaging
23-5501-1mg
Price
$336
Updated
2021/12/16
Sigma-Aldrich
Product number
1643962
Product name
Parathyroid Hormone Fragment 1-34 human
Packaging
1mg
Price
$383
Updated
2021/12/16
More
Less

Teriparatide acetate Chemical Properties,Usage,Production

Application in Particular Diseases

In Osteoporosis:

  • Teriparatide is a recombinant product representing the first 34 amino acids in human parathyroid hormone. Teriparatide increases bone formation, the bone remodeling rate, and osteoblast number and activity. Both bone mass and architecture are improved.
  • Teriparatide is FDA approved for postmenopausal women and men who are at high risk for fracture. Candidates for therapy include patients with a history of osteoporotic fracture, multiple risk factors for fracture, very low bone density (e.g., T-score <–3.5), or those who have failed or are intolerant of previous bisphosphonate therapy.
  • The drug reduces fracture risk in postmenopausal women, but no fracture data are available in men. Lumbar spine BMD increases are higher than with any other osteoporosis therapy. Although wrist BMD is decreased, wrist fractures are not increased.
  • Discontinuation of therapy results in a decrease in BMD, but some antifracture efficacy appears to be maintained. Sequential therapy with teriparatide followed by an antiresorptive agent (e.g., bisphosphonate) should be considered to maintain BMD gains.
  • The dose is 20 mcg administered subcutaneously in the thigh or abdominal area (see Table 3-4). The initial dose should be given with the patient either lying or sitting, in case orthostatic hypotension occurs. Each prefilled 3-mL pen device delivers a 20-mcg dose each day for up to 28 days; the pen device should be kept refrigerated.
  • Transient hypercalcemia rarely occurs. A trough serum calcium concentration is recommended 1 month after initiation of therapy.
  • Teriparatide is contraindicated in patients at baseline increased risk for osteosarcoma (e.g., Paget’s bone disease, unexplained alkaline phosphatase elevations, pediatric patients, young adults with open epiphyses, or patients with prior radiation therapy involving the skeleton).

Uses

A fragment of human parathyroid hormone (hPTH) peptide sequence containing the 34 N-terminal residues of hPTH. This fragment was also found to be an agonist at PTH1 and PTH2 receptors.

General Description

Teriparatide is a recombinantform of parathyroid hormone, which is used for the treatmentof osteoporosis in men and postmenopausal women.The N-terminal region possesses 34 amino acids, which areidentical to the biologically active region of the 84-aminoacid sequence of human parathyroid hormone. It has beenshown to act on osteoblasts to stimulate new bone growthand improve bone density.

Biochem/physiol Actions

Parathyroid hormone (PTH) is a parathyroid-secreted polypeptide hormone that increases the level of calcium in blood by enhancing calcium mobilization from bone, increasing the calcium:phosphate ratio in the kidney and promoting the absorption of calcium by the intestines. PTH is an anabolic agent that improves osteoblastic bone development. PTH 1-34 induces bone morphogenetic protein (BMP) gene transcription. Active N-terminal fragment of PTH (residues 1–34), has been used as a therapeutic for postmenopausal women with osteoporosis who are at high risk for fracture.

Pharmacokinetics

If administered once daily or intermittently, teriparatide preferentially enhances osteoblastic function,and bone formation occurs. Continuous exposure to endogenous PTH may result in poor skeletal composition because of enhanced osteoclast-mediated bone resorption. After 18 months of treatment, lumbar BMD increased up to 12% in postmenopausal women. After 10 months of treatment, 53% of men had an increase of 5% or greater in spine BMD. The risk for developing new vertebral fractures was reduced by 65% after 21 months of treatment, and the number of nonvertebral fragility fractures was reduced by 53%.

Clinical Use

In 2002, the U.S. FDA approved teriparatide for the treatment of postmenopausal osteoporosis in patients who have a high risk of fracture as well as to increase bone mass in men with primary or hypogonadal osteoporosis who have a high risk of fracture. Teriparatide is recombinant human PTH 1-34, the biologically active portion of the endogenously produced preprohormone. Unlike the bisphosphonates, which are classified as bone restorative agents, teriparatide is the first approved bone-forming agent. Bone formation is possible because of the ability of this agent to increase the number of osteoblasts. Although teriparatide enhances the function of both osteoclasts and osteoblasts, the exposure incidence dictates its effect on the skeleton.

Side effects

Temporary increases in serum calcium levels occur following administration of teriparatide. As a result, this agent is contraindicated in patients who are predisposed to hypercalcemia. Some evidence suggests that these elevations in serum calcium levels may cause a patient who is taking digitalis to experience digitalis toxicity (39). Teriparatide should not be prescribed to patients with Paget's disease, children, young adults, women who are pregnant or nursing, and those patients who have received skeletal radiation therapy. Because of an increased incidence of osteosarcoma (malignant bone tumors) observed in rats, teriparatide also carries a black box warning

Teriparatide acetate Preparation Products And Raw materials

Raw materials

Preparation Products

More
Less

Teriparatide acetate Suppliers

Avantpbc Chemical Tech(Shanghai) Co,Ltd.
Tel
17802107445;021-3120-8408
Country
China
ProdList
186
Advantage
55
Shanghai Mokay Pharmaceutical Technology Co., Ltd.
Tel
021-60257269 18601606476
Fax
+86-21-60253672
Email
yl@mkpharma.cn
Country
China
ProdList
206
Advantage
58
Twochem Co.Ltd.
Tel
021-58111628-
Fax
QQ 3285589261
Email
sales@azbiochem.com
Country
China
ProdList
1985
Advantage
58
Hangzhou Xinhai Pharmaceutical Technology Co., Ltd.
Tel
571-86758863-
Fax
0571-86758863
Email
lulu@thinheal.com
Country
China
ProdList
299
Advantage
58
Nanjing Hanxin Pharmaceutical Technology Co., Ltd.
Tel
025-85807880-661
Fax
025-52809826
Email
fenglingn@amphastar.cn
Country
China
ProdList
53
Advantage
58
Enzpro Biotechnology Co., Ltd.
Tel
Email
sales@enzpro.com
Country
China
ProdList
17
Advantage
58
Sichuan Jisheng Biopharmaceutical Co.,Ltd.
Tel
0833-2598983-
Email
sales-a@jsjpharm.cn
Country
China
ProdList
305
Advantage
58
J & K SCIENTIFIC LTD.
Tel
010-82848833- ;010-82848833-
Fax
86-10-82849933
Email
jkinfo@jkchemical.com;market6@jkchemical.com
Country
China
ProdList
96815
Advantage
76
3B Pharmachem (Wuhan) International Co.,Ltd.
Tel
821-50328103-801
Fax
86-21-50328109
Email
3bsc@sina.com
Country
China
ProdList
15877
Advantage
69
Alabiochem Tech.Co., Ltd.
Tel
0512-58900862;0512-56727736
Fax
0086-512-56765862
Email
sales@alabiochem.com;sales@alabiochem.com
Country
China
ProdList
1005
Advantage
59
More
Less

View Lastest Price from Teriparatide acetate manufacturers

Hangzhou Go Top Peptide Biotech
Product
Teriparatide 52232-67-4
Price
US $0.00/ASSAYS
Min. Order
1ASSAYS
Purity
98%
Supply Ability
KG
Release date
2021-09-28
Hebei Yirun Sega Biological Technology Co. Ltd
Product
Teriparatide Acetate 52232-67-4
Price
US $50.00-1200.00/BOX
Min. Order
1BOX
Purity
99%
Supply Ability
500ton/Month
Release date
2021-08-25
WUHAN FORTUNA CHEMICAL CO., LTD
Product
Teriparatide acetate 52232-67-4
Price
US $0.00/kit
Min. Order
1g
Purity
98%min
Supply Ability
1000g/month
Release date
2021-06-05

52232-67-4, Teriparatide acetateRelated Search:


  • PARATHYROID HORMONE HUMAN: FRAGMENT 1-34
  • PARATHYROID HORMONE (HUMAN, 1-34)
  • PARATHYROID HORMONE (1-34), HUMAN
  • PTH (1-34) (HUMAN)
  • PTH (HUMAN, 1-34)
  • TERIPARATIDE
  • Teriparatide acetate
  • SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
  • SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE
  • SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE HUMAN
  • Pth(1-34)(human) Acetate
  • Parathormone (1-34)
  • [CYS5,28] PARATHYROID HORMONE (1-34), HUMAN
  • [CYS5,28] PTH (1-34), HUMAN
  • H-SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE-OH
  • Parathyroid Hormone (PTH) (1-34), Human
  • Teroparatide
  • Teriparatide (Forteo)
  • CNV-38d(1-34)
  • Teriparatide, Teriparatida , Teriparatidum
  • Teriparatide (PTH 1-34)
  • PARATHYROID HORMONE FRAGMENT HUMAN 1-34 APPROX. 95%
  • PARATHYROID HORMONE FRAGMENT HUMAN 1-34 90-95%
  • Teriparatide, Parathyroid Hormone(1-34),human
  • parathyroid hormone fragment 1-34 human
  • PARATHYROID HORMONE (PTH) HUMAN 1-34, MIN 95%
  • (1-34)-HUMAN PARATHYROID HORMONE
  • Teriparatide, Parathyroid Hormone(1-34)
  • ALA-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ALA-SER-VAL-GLU-ARG-MET-GLN-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE: AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF
  • SER-VAL-SER-GLU-CYS-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-CYS-GLN-ASP-VAL-HIS-ASN-PHE
  • Teriparatide acetate/HuMan PTH(1-34)
  • M.W. 4117.72 C181H291N55O51S2
  • Parathyroid Hormone Fragment (1-34)
  • H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH acetate salt
  • hPTH (1-34)
  • PTH 1-34;HPTH (1-34);HUMAN PARATHYROID HORMONE-(1-34)
  • Pterospermum heterophyllum Hance.
  • Parathyroid Hormone 1-34, Human - CAS 52232-67-4 - Calbiochem
  • Teriparatide,PTH 1-34,hPTH (1-34),Human parathyroid hormone-(1-34), >99%
  • Teriparatide CRS
  • Teriparatide Acetate fandachem
  • Teriparatide?Acetate impurity
  • Teriparatide acetate USP/EP/BP
  • Teriparatide,PTH 1-34,hPTH (1-34),Human parathyroid hormone-(1-34)
  • Teriparatide Acetate/pTH(1-34) human
  • Pteris formosana extract
  • 52232-67-4
  • C181H291N55O51S2
  • C181H291N55O51S2C2H4O2
  • Biochemicals and Reagents
  • BioChemical
  • Amino Acids and Peptides
  • Cell Signaling and Neuroscience
  • Cell Biology
  • Other Protein/Peptide Hormones
  • Parathyroid Hormone Fragments
  • Parathyroid Hormone (PTH)
  • Peptides