Teriparatide acetate

Application in Particular Diseases

Product Name: Teriparatide acetate
CAS No.: 52232-67-4
Chemical Name: Teriparatide acetate
Synonyms: Parathar;hPTH (1-34);Teriparatid;Teroparatide;CNV-38d(1-34);Teriparatide CRS;PTH (HUMAN, 1-34);Teriparatida(net);PTH (1-34) (HUMAN);Parathormone (1-34)
CBNumber: CB2284468
Molecular Formula: C172H278N52O47S2
Formula Weight: 3890.49792
MOL File: 52232-67-4.mol

More

Less

Teriparatide acetate Property

Melting point:: >205oC (dec.)
RTECS: SQ7770000
storage temp.: −20°C
solubility: DMSO (Slightly), Water (Slightly)
form: powder
color: White to Off-White
Water Solubility: Soluble to 0.40 mg/ml in water
Sequence: H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
Stability:: Hygroscopic
CAS DataBase Reference: 52232-67-4(CAS DataBase Reference)

More

Less

Safety

WGK Germany: 3
HS Code: 2937190000
Hazardous Substances Data: 52232-67-4(Hazardous Substances Data)

More

Less

Hazard and Precautionary Statements (GHS)

Symbol(GHS)

Signal word

Warning

Hazard statements

H227Combustible liquid

H302Harmful if swallowed

Precautionary statements

P210Keep away from heat/sparks/open flames/hot surfaces. — No smoking.

P264Wash hands thoroughly after handling.

P264Wash skin thouroughly after handling.

P270Do not eat, drink or smoke when using this product.

P280Wear protective gloves/protective clothing/eye protection/face protection.

P301+P312IF SWALLOWED: call a POISON CENTER or doctor/physician IF you feel unwell.

P330Rinse mouth.

P370+P378In case of fire: Use … for extinction.

P403+P235Store in a well-ventilated place. Keep cool.

P501Dispose of contents/container to..…

More

Less

N-Bromosuccinimide Price

Sigma-Aldrich

Product number: Y0001916
Product name: Teriparatide
Purity: European Pharmacopoeia (EP) Reference Standard
Packaging: Y0001916
Price: $201
Updated: 2024/03/01

Sigma-Aldrich

Product number: P3796
Product name: Parathyroid Hormone Fragment 1-34 human
Purity: ≥95% (HPLC), powder
Packaging: 0.1mg
Price: $178
Updated: 2024/03/01

Sigma-Aldrich

Product number: P3796
Product name: Parathyroid Hormone Fragment 1-34 human
Purity: ≥95% (HPLC), powder
Packaging: 0.5mg
Price: $271
Updated: 2024/03/01

Sigma-Aldrich

Product number: 1643962
Product name: Parathyroid Hormone Fragment 1-34 human
Packaging: 1mg
Price: $1530
Updated: 2024/03/01

Sigma-Aldrich

Product number: 05-23-5501
Product name: Parathyroid Hormone 1-34, Human - CAS 52232-67-4 - Calbiochem
Purity: N-terminal active peptide fragment of the native hormone that functions as a regulatory factor in the homeostatic control of Ca2+ and phosphate metabolism.
Packaging: 1mg
Price: $433
Updated: 2024/03/01

More

Less

Teriparatide acetate Chemical Properties,Usage,Production

Application in Particular Diseases

In Osteoporosis:

Teriparatide is a recombinant product representing the first 34 amino acids in human parathyroid hormone. Teriparatide increases bone formation, the bone remodeling rate, and osteoblast number and activity. Both bone mass and architecture are improved.
Teriparatide is FDA approved for postmenopausal women and men who are at high risk for fracture. Candidates for therapy include patients with a history of osteoporotic fracture, multiple risk factors for fracture, very low bone density (e.g., T-score <–3.5), or those who have failed or are intolerant of previous bisphosphonate therapy.
The drug reduces fracture risk in postmenopausal women, but no fracture data are available in men. Lumbar spine BMD increases are higher than with any other osteoporosis therapy. Although wrist BMD is decreased, wrist fractures are not increased.
Discontinuation of therapy results in a decrease in BMD, but some antifracture efficacy appears to be maintained. Sequential therapy with teriparatide followed by an antiresorptive agent (e.g., bisphosphonate) should be considered to maintain BMD gains.
The dose is 20 mcg administered subcutaneously in the thigh or abdominal area (see Table 3-4). The initial dose should be given with the patient either lying or sitting, in case orthostatic hypotension occurs. Each prefilled 3-mL pen device delivers a 20-mcg dose each day for up to 28 days; the pen device should be kept refrigerated.
Transient hypercalcemia rarely occurs. A trough serum calcium concentration is recommended 1 month after initiation of therapy.
Teriparatide is contraindicated in patients at baseline increased risk for osteosarcoma (e.g., Paget’s bone disease, unexplained alkaline phosphatase elevations, pediatric patients, young adults with open epiphyses, or patients with prior radiation therapy involving the skeleton).

Description

The anabolic drug teriparatide acetate (TA), known as recombinant human parathyroid hormone 1–34, which directly promotes bone formation by generating new osteocytes, has been introduced as a novel therapeutic agent for osteoporosis. Distinct from antiresorptive drug treatment, patients with osteonecrosis of the jaw showed successful clinical outcomes after weekly administration of TA. In addition, adverse outcomes of long-term bisphosphonate treatment, such as bone fracture, were healed after usage of TA, and better bone mass and mineral density improvements at the lumbar spine and femoral neck were achieved with TA treatment than with bisphosphonate treatment[1].

Uses

A fragment of human parathyroid hormone (hPTH) peptide sequence containing the 34 N-terminal residues of hPTH. This fragment was also found to be an agonist at PTH1 and PTH2 receptors.

General Description

Teriparatide is a recombinantform of parathyroid hormone, which is used for the treatmentof osteoporosis in men and postmenopausal women.The N-terminal region possesses 34 amino acids, which areidentical to the biologically active region of the 84-aminoacid sequence of human parathyroid hormone. It has beenshown to act on osteoblasts to stimulate new bone growthand improve bone density.

Biological Activity

parathyroid hormone (1-34) (human), (c181h291n55o51s2), a peptide with the sequence h2n-svseiqlmhnlgkhlnsmervewlrkklqdvhnf-oh, mw= 4117.72. parathyroid hormone (pth), parathormone or parathyrin, is secreted by the chief cells of the parathyroid glands as a polypeptide containing 84 amino acids. it acts to increase the concentration of calcium (ca2+) in the blood, whereas calcitonin (a hormone produced by the parafollicular cells (c cells) of the thyroid gland) acts to decrease calcium concentration. pth acts to increase the concentration of calcium in the blood by acting upon the parathyroid hormone 1 receptor and the parathyroid hormone 2 receptor(1). parathyroid hormone regulates serum calcium, it enhances the release of calcium from the large reservoir contained in the bones(2). it enhances active reabsorption of calcium and magnesium from distal tubules and the thick ascending limb(3). it enhances the absorption of calcium in the intestine by increasing the production of activated vitamin d.figure1 formula of parathyroid hormone (1-34) (human)figure2 the parathyroid hormone (pth) system

Biochem/physiol Actions

Parathyroid hormone (PTH) is a parathyroid-secreted polypeptide hormone that increases the level of calcium in blood by enhancing calcium mobilization from bone, increasing the calcium:phosphate ratio in the kidney and promoting the absorption of calcium by the intestines. PTH is an anabolic agent that improves osteoblastic bone development. PTH 1-34 induces bone morphogenetic protein (BMP) gene transcription. Active N-terminal fragment of PTH (residues 1–34), has been used as a therapeutic for postmenopausal women with osteoporosis who are at high risk for fracture.

Mechanism of action

Teriparatide acetate is the salt form of teriparatide and has a similar mechanism of action to teriparatide. Teriparatide is a parathyroid hormone (PTH) analogue that regulates calcium and phosphate metabolism in bone and kidney by binding to the PTH type 1 receptor (PTH1R type) via the N-terminal portion. It has the same effect on calcium-phosphorus homeostasis as endogenous PTH (i.e., increases serum calcium and decreases serum phosphorus).

Pharmacokinetics

If administered once daily or intermittently, teriparatide preferentially enhances osteoblastic function,and bone formation occurs. Continuous exposure to endogenous PTH may result in poor skeletal composition because of enhanced osteoclast-mediated bone resorption. After 18 months of treatment, lumbar BMD increased up to 12% in postmenopausal women. After 10 months of treatment, 53% of men had an increase of 5% or greater in spine BMD. The risk for developing new vertebral fractures was reduced by 65% after 21 months of treatment, and the number of nonvertebral fragility fractures was reduced by 53%.

Clinical Use

In 2002, the U.S. FDA approved teriparatide for the treatment of postmenopausal osteoporosis in patients who have a high risk of fracture as well as to increase bone mass in men with primary or hypogonadal osteoporosis who have a high risk of fracture. Teriparatide is recombinant human PTH 1-34, the biologically active portion of the endogenously produced preprohormone. Unlike the bisphosphonates, which are classified as bone restorative agents, teriparatide is the first approved bone-forming agent. Bone formation is possible because of the ability of this agent to increase the number of osteoblasts. Although teriparatide enhances the function of both osteoclasts and osteoblasts, the exposure incidence dictates its effect on the skeleton.

Side effects

Temporary increases in serum calcium levels occur following administration of teriparatide. As a result, this agent is contraindicated in patients who are predisposed to hypercalcemia. Some evidence suggests that these elevations in serum calcium levels may cause a patient who is taking digitalis to experience digitalis toxicity (39). Teriparatide should not be prescribed to patients with Paget's disease, children, young adults, women who are pregnant or nursing, and those patients who have received skeletal radiation therapy. Because of an increased incidence of osteosarcoma (malignant bone tumors) observed in rats, teriparatide also carries a black box warning

storage

Store at -20°C

Dosage

Teriparatide acetate requires subcutaneous injection into the thigh or abdominal wall, and the recommended dose is 20 mcg once daily. If symptoms of orthostatic hypotension occur, it is administered while the patient is sitting or lying down. It is not recommended to use the drug for more than 2 years in the lifetime of the patient. Use teriparatide injection with caution in patients receiving digoxin. Transient hypercalcemia may predispose patients to digitalis toxicity.

References

[1] Jeeho Sim. “Development of Clinical Weekly-Dose Teriparatide Acetate Encapsulated Dissolving Microneedle Patch for Efficient Treatment of Osteoporosis.” Polymers (2022).

Teriparatide acetate Preparation Products And Raw materials

Raw materials

Preparation Products

More

Less

Teriparatide acetate Suppliers

Canada 1 China 356 Europe 3 France 1 Germany 5 India 4 Japan 2 South Korea 1 Switzerland 3 United Kingdom 4 United States 30 USA 1 Global 411

LGM Pharma

Tel: 1-(800)-881-8210
Fax: 615-250-9817
Email: inquiries@lgmpharma.com
Country: United States
ProdList: 2123
Advantage: 70

MedChemexpress LLC

Tel: 021-58955995
Fax: 609-228-5909
Email: sales@medchemexpress.cn
Country: United States
ProdList: 4861
Advantage: 58

ApexBio Technology LLC

Tel: +1-832-696-8203
Fax: +1-832-641-3177
Email: info@apexbt.com
Country: United States
ProdList: 477
Advantage: 60

HBCChem, Inc.

Tel: +1-510-219-6317
Fax: +1-650-486-1361
Email: sales@hbcchem.com
Country: United States
ProdList: 10648
Advantage: 60

Creative Peptides

Tel
Email: info@creative-peptides.com
Country: United States
ProdList: 6083
Advantage: 56

Musechem

Tel: +1-800-259-7612
Fax: +1-800-259-7612
Email: info@musechem.com
Country: United States
ProdList: 4660
Advantage: 60

BOC Sciences

Tel: 16314854226; +16314854226
Email: inquiry@bocsci.com
Country: United States
ProdList: 19741
Advantage: 58

TargetMol Chemicals Inc.

Tel: +1-781-999-5354 +1-00000000000
Email: marketing@targetmol.com
Country: United States
ProdList: 32165
Advantage: 58

Alchem Pharmtech,Inc.

Tel: 8485655694
Email: sales@alchempharmtech.com
Country: United States
ProdList: 63687
Advantage: 58

TargetMol Chemicals Inc.

Tel
Email: support@targetmol.com
Country: United States
ProdList: 38632
Advantage: 58

Aladdin Scientific

Tel: +1-+1(833)-552-7181
Email: sales@aladdinsci.com
Country: United States
ProdList: 57505
Advantage: 58

Protheragen-ING

Tel: +16313385890
Email: info@protheragen-ing.com
Country: United States
ProdList: 3868
Advantage: 58

United States Biological

Tel: --
Fax: --
Email: sales@advtechind.com
Country: United States
ProdList: 6075
Advantage: 58

ApexBio Technology

Tel: --
Fax: --
Email: sales@apexbt.com
Country: United States
ProdList: 6251
Advantage: 58

United States Biological

Tel: --
Fax: --
Email: chemicals@usbio.net
Country: United States
ProdList: 6214
Advantage: 80

MedChemExpress

Tel: --
Fax: --
Email: sales@medchemexpress.com
Country: United States
ProdList: 6398
Advantage: 58

Riedel-de Haen AG

Tel: --
Fax: --
Country: United States
ProdList: 6773
Advantage: 87

Peptides International, Inc.

Tel: --
Fax: --
Email: peptides@pepnet.com
Country: United States
ProdList: 555
Advantage: 72

Selleck Chemicals LLC

Tel: --
Fax: --
Email: info@selleckchem.com
Country: United States
ProdList: 824
Advantage: 60

Waterstone Technology, LLC

Tel: --
Fax: --
Email: sales@waterstonetech.com
Country: United States
ProdList: 6786
Advantage: 30

Accurate Chemical & Scientific Corporation.

Tel: --
Fax: --
Country: United States
ProdList: 6747
Advantage: 72

AK Scientific, Inc.

Tel: --
Fax: --
Email: sales@aksci.com
Country: United States
ProdList: 6347
Advantage: 65

The Peptide Laboratory

Tel: --
Fax: --
Email: info@peptidelab.com
Country: United States
ProdList: 224
Advantage: 30

GenScript Corporation

Tel: --
Fax: --
Email: info@genscript.com
Country: United States
ProdList: 400
Advantage: 77

Chem-Impex International, Inc.

Tel: --
Fax: --
Country: United States
ProdList: 6730
Advantage: 64

American Peptide Company

Tel: --
Fax: --
Email: sales@americanpeptide.com
Country: United States
ProdList: 1718
Advantage: 71

AnaSpec, Inc.

Tel: --
Fax: --
Email: service@anaspec.com
Country: United States
ProdList: 4871
Advantage: 77

SynPep Corporation

Tel: --
Fax: --
Email: sales@synpep.com
Country: United States
ProdList: 1943
Advantage: 51

Research Plus, Inc.

Tel: --
Fax: --
Email: respls@aol.com
Country: United States
ProdList: 3674
Advantage: 51

EMD Biosciences, Inc.

Tel: --
Fax: --
Email: technical@calbiochem.com
Country: United States
ProdList: 6529
Advantage: 66

More

Less

View Lastest Price from Teriparatide acetate manufacturers

hebei hongtan Biotechnology Co., Ltd

Product: Teriparatide acetate 52232-67-4
Price: US $30.00/box
Min. Order: 1box
Purity: 99%
Supply Ability: 2000kg
Release date: 2024-03-20

HEBEI SHENGSUAN CHEMICAL INDUSTRY CO.,LTD

Product: Teriparatide acetate 52232-67-4
Price: US $100.00-75.00/kg
Min. Order: 1kg
Purity: 99%
Supply Ability: 5000Ton
Release date: 2024-08-13

Dorne Chemical Technology co. LTD

Product: Teriparatide acetate 52232-67-4
Price: US $1.00/g
Min. Order: 1g
Purity: 99%
Supply Ability: 100kg
Release date: 2024-03-26

52232-67-4, Teriparatide acetateRelated Search:

Oxytocin Melanotan II Cosyntropin Terlipressin acetate Teriparatideacetate Lixisenatide Angiotensin acetate Pramlintide acetate ARG-LYS-GLU-VAL-TYR ACETATE SALT Desmopressin Secretin Acetate Triptorelin acetate Nafarelin Acetate Ganirelix Leuprorelin acetate Eptifibatide Acetate Eledoisin VAPREOTIDE

PARATHYROID HORMONE HUMAN: FRAGMENT 1-34

PARATHYROID HORMONE (HUMAN, 1-34)

PARATHYROID HORMONE (1-34), HUMAN

PTH (1-34) (HUMAN)

PTH (HUMAN, 1-34)

Teriparatide acetate

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE HUMAN

Pth(1-34)(human) Acetate

Parathormone (1-34)

[CYS5,28] PARATHYROID HORMONE (1-34), HUMAN

[CYS5,28] PTH (1-34), HUMAN

H-SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE-OH

Parathyroid Hormone (PTH) (1-34), Human

Teroparatide

Teriparatide (Forteo)

CNV-38d(1-34)

Teriparatide, Teriparatida , Teriparatidum

Teriparatide (PTH 1-34)

PARATHYROID HORMONE FRAGMENT HUMAN 1-34 APPROX. 95%

PARATHYROID HORMONE FRAGMENT HUMAN 1-34 90-95%

Teriparatide, Parathyroid Hormone(1-34),human

parathyroid hormone fragment 1-34 human

PARATHYROID HORMONE (PTH) HUMAN 1-34, MIN 95%

(1-34)-HUMAN PARATHYROID HORMONE

Teriparatide, Parathyroid Hormone(1-34)

ALA-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ALA-SER-VAL-GLU-ARG-MET-GLN-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE: AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF

SER-VAL-SER-GLU-CYS-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-CYS-GLN-ASP-VAL-HIS-ASN-PHE

Teriparatide acetate/HuMan PTH(1-34)

M.W. 4117.72 C181H291N55O51S2

Parathyroid Hormone Fragment (1-34)

H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH acetate salt

hPTH (1-34)

PTH 1-34;HPTH (1-34);HUMAN PARATHYROID HORMONE-(1-34)

Pterospermum heterophyllum Hance.

Parathyroid Hormone 1-34, Human - CAS 52232-67-4 - Calbiochem

Teriparatide,PTH 1-34,hPTH (1-34),Human parathyroid hormone-(1-34), >99%

Teriparatide CRS

Teriparatide?Acetate impurity

Teriparatide acetate USP/EP/BP

Teriparatide，PTH 1-34，hPTH (1-34)，Human parathyroid hormone-(1-34)

Teriparatide Acetate/pTH(1-34) human

Pteris formosana extract

Teriparatide D10 AcetateQ: What is Teriparatide D10 Acetate Q: What is the CAS Number of Teriparatide D10 Acetate Q: What is the storage condition of Teriparatide D10 Acetate Q: What are the applications of Teriparatide D10 Acetate

TeriparatideAcetateQ: What is TeriparatideAcetate Q: What is the CAS Number of TeriparatideAcetate Q: What is the storage condition of TeriparatideAcetate Q: What are the applications of TeriparatideAcetate

Teriparatida(net)

pTH (1-34) (human) Acetate(net)

Teriparatide (COLD SHIPMENT REQUIRED) (1643962)

Teriparatide (Y0001916)

Teriparatide for system suitability (Y0001895)

leriparatide acetate

TeripaRatide Acetate peptide

Terliparatide Acetate

Teriparatide acetate Powder

CNV-38d(1-34),Parathyroid Hormone (1-34), human

Parathar

Teriparatide Acetate（free base)