H-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-NH2
- Product Name
- H-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-NH2
- CAS No.
- 150138-78-6
- Chemical Name
- H-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-NH2
- Synonyms
- NPY 3-36;NPY (3-36), HUMAN;NPY (3-36) (HUMAN, RAT);Human neuropeptide Y(3-36);NEUROPEPTIDE Y (3-36) HUMAN;3-36-Neuropeptide Y (human);NEUROPEPTIDE Y (3-36) (HUMAN, RAT);Neuropeptide Y Fragment 3-36 human;SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2;Neuropeptide Y Fragment 3-36 human, ra
- CBNumber
- CB3114773
- Molecular Formula
- C175H269N53O54S1
- Formula Weight
- 4011.4
- MOL File
- Mol file
H-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-NH2 Property
- storage temp.
- −20°C
- form
- Solid
- color
- White to off-white
- Sequence
- Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
Safety
- WGK Germany
- 3
N-Bromosuccinimide Price
- Product number
- N9407
- Product name
- Neuropeptide Y Fragment 3-36 human, rat
- Purity
- ≥95% (HPLC)
- Packaging
- 250μg
- Price
- $209.59
- Updated
- 2025/07/31
H-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-NH2 Chemical Properties,Usage,Production
Uses
Neuropeptide Y (3-36) (human, rat), a neuropeptide Y (NPY) metabolite formed from dipeptidyl peptidase-4 (DPP4), is a selective Y2 receptor agonist. Neuropeptide Y (3-36) (human, rat) is a NPY metabolite formed from dipeptidyl peptidase-4 (DPP4). Neuropeptide Y (3-36) (human, rat) decreases release of norepinephrine via the Y2 receptor[1][2].
IC 50
NPY Y2 receptor
References
[1] Hubers SA, et al. DPP (Dipeptidyl Peptidase)-4 Inhibition Potentiates the Vasoconstrictor Response to NPY (Neuropeptide Y) in Humans During Renin-Angiotensin-Aldosterone System Inhibition. Hypertension. 2018;72(3):712-719. DOI:10.1161/HYPERTENSIONAHA.118.11498
[2] Grandt D, et al. Neuropeptide Y 3-36 is an endogenous ligand selective for Y2 receptors. Regul Pept. 1996;67(1):33-37. DOI:10.1016/s0167-0115(96)00104-8
H-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-NH2 Preparation Products And Raw materials
Raw materials
Preparation Products
H-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-NH2 Suppliers
- Tel
- 21-61263452 13641803416
- Fax
- 86-21-61263399
- ymbetter@glbiochem.com
- Country
- China
- ProdList
- 9981
- Advantage
- 64
- Tel
- 021-54306202 13764082696
- info@hanhongsci.com
- Country
- China
- ProdList
- 42934
- Advantage
- 64
- Tel
- 021-50135380
- shchemsky@sina.com
- Country
- China
- ProdList
- 15402
- Advantage
- 60
- Tel
- 0731-85526065 13308475853
- ivy@hnhbsj.com
- Country
- China
- ProdList
- 7247
- Advantage
- 62
- Tel
- 0551-65326643 18156095617
- Fax
- 0551-65326641
- info@cellmano.com
- Country
- China
- ProdList
- 1010
- Advantage
- 55
- Tel
- 400-0066400 13621662912
- Fax
- 021-55660885
- 422131432@qq.com
- Country
- China
- ProdList
- 9979
- Advantage
- 55
- Tel
- 18620099427
- Fax
- +86-20-62619665
- amy@howeipharm.com
- Country
- China
- ProdList
- 6687
- Advantage
- 55
- Tel
- 17705183659
- Fax
- 84523390
- sales@njleonbiotech.com
- Country
- China
- ProdList
- 5501
- Advantage
- 55
- Tel
- 025-58361106-805 15951641583
- Fax
- 025-58361106-806
- zhao.xu@njpeptide.com
- Country
- China
- ProdList
- 9979
- Advantage
- 55
- Tel
- +86-17380623303
- Fax
- 028-62328193
- Caroline@youngshechem.com
- Country
- China
- ProdList
- 4802
- Advantage
- 58
- Tel
- 0571-87213919
- Eric@peptidego.com
- Country
- China
- ProdList
- 7408
- Advantage
- 58
- Tel
- meitaochem@126.com
- meitaochem@126.com
- Country
- China
- ProdList
- 19103
- Advantage
- 58
- Tel
- 0571-88211921
- sales1@gotopbio.com
- Country
- CHINA
- ProdList
- 2609
- Advantage
- 58
- Tel
- +86-0371-86658258 +8613203830695
- Fax
- 0371-86658258
- laboratory@coreychem.com
- Country
- China
- ProdList
- 30229
- Advantage
- 58
- Tel
- 18108052721
- 2850505130@qq.com
- Country
- China
- ProdList
- 5167
- Advantage
- 58
- Tel
- 0551-65326643 18156095617
- Fax
- 0551-65326641
- info@cellmano.com
- Country
- China
- ProdList
- 995
- Advantage
- 58
- Tel
- 19850819832
- 2173594524@qq.com
- Country
- China
- ProdList
- 2638
- Advantage
- 58
- Tel
- 021-61263455 13167021076
- amy@glschina.com
- Country
- China
- ProdList
- 9736
- Advantage
- 58
- Tel
- 13758194781 13173652190
- 522013271@qq.com
- Country
- China
- ProdList
- 2395
- Advantage
- 58
- Tel
- 18115476705
- sales@tgpeptide.com
- Country
- China
- ProdList
- 3058
- Advantage
- 58
- Tel
- 15397062932
- sales1@gotopbio.com
- Country
- China
- ProdList
- 2923
- Advantage
- 58
- Tel
- 010-60605840 15801484223;
- psaitong@jm-bio.com
- Country
- China
- ProdList
- 29757
- Advantage
- 58
- Tel
- 13675144456
- alan.chow@synzest.com
- Country
- China
- ProdList
- 9470
- Advantage
- 58
- Tel
- 18168071971
- support@yuan-peptide.com
- Country
- China
- ProdList
- 2983
- Advantage
- 58
- Tel
- 17711399154
- 3211919385@qq.com
- Country
- China
- ProdList
- 1815
- Advantage
- 58
- Tel
- 0571-0571-88211921 19105816207
- sales4@gotopbio.com
- Country
- China
- ProdList
- 5144
- Advantage
- 58
- Tel
- 0571-87213919 17306812703
- 3007955328@qq.com
- Country
- China
- ProdList
- 6979
- Advantage
- 58
- Tel
- 0571-85350119 15888826472
- 15888826472@163.com
- Country
- China
- ProdList
- 2729
- Advantage
- 58
- Tel
- 15318089928
- alex@hanhonggroup.com
- Country
- China
- ProdList
- 4604
- Advantage
- 58
- Tel
- 17751201929
- office@combiosz.com
- Country
- China
- ProdList
- 3000
- Advantage
- 58
- Tel
- 021-54306202 18917919676
- info@hanhongsci.com
- Country
- China
- ProdList
- 29995
- Advantage
- 58
- Tel
- 13053322091
- admin@mopaikeji.com
- Country
- China
- ProdList
- 5830
- Advantage
- 58
- Tel
- 13327808530
- 2670965693@qq.com
- Country
- China
- ProdList
- 2179
- Advantage
- 58
- Tel
- 0571-88211951 13735575465
- sales1@gotopbio.com
- Country
- China
- ProdList
- 4880
- Advantage
- 58
- Tel
- 19135651983
- 18611134419@163.com
- Country
- China
- ProdList
- 4416
- Advantage
- 58
- Tel
- 0571-85350119 15888826472
- bptsales@163.com
- Country
- China
- ProdList
- 3834
- Advantage
- 58
- Tel
- 0745-2866551 19976851779
- 3002713163@qq.com
- Country
- China
- ProdList
- 7333
- Advantage
- 58
- Tel
- Enzo Biochem Inc. 13797054060
- Enzoname@qq.com
- Country
- China
- ProdList
- 6174
- Advantage
- 58
- Tel
- 51288865780
- sales@biosynth.com
- Country
- China
- ProdList
- 6051
- Advantage
- 58
- Tel
- 17320513646
- anna@molcoo.com
- Country
- China
- ProdList
- 3256
- Advantage
- 58
- Tel
- 021-60936350
- scbt@scbt.com
- Country
- China
- ProdList
- 6594
- Advantage
- 58
- Tel
- 0512-67583809
- sales@cohesionbio.com
- Country
- China
- ProdList
- 6282
- Advantage
- 58
- Tel
- 19941518170
- sales@typeptide.com
- Country
- China
- ProdList
- 3920
- Advantage
- 58
- Tel
- 17342063383
- sales@allpeptide.com
- Country
- China
- ProdList
- 5320
- Advantage
- 58
- Tel
- 18178976185
- 3855357086@qq.com
- Country
- China
- ProdList
- 2048
- Advantage
- 58
- Tel
- +8615051830413
- sales.njleonbiotech@gmail.com
- Country
- China
- ProdList
- 5482
- Advantage
- 58
- Tel
- +86-17320513646 +8617320513646
- anna@molcoo.com
- Country
- China
- ProdList
- 10000
- Advantage
- 58
- Tel
- +8619375158599
- info@molchanges.com
- Country
- China
- ProdList
- 5218
- Advantage
- 58
- Tel
- +86-755-89396905 +86-15013857715
- admin@nexconn.com
- Country
- China
- ProdList
- 10405
- Advantage
- 58
- Tel
- +86-13347807150
- support@tgpeptide.com
- Country
- China
- ProdList
- 3279
- Advantage
- 58