CECROPIN B
- Product Name
- CECROPIN B
- CAS No.
- 80451-05-4
- Chemical Name
- CECROPIN B
- Synonyms
- CECROPIN B;Aids096161;Aids-096161;Cecropin B - 0.5 mg;Cecropin B, ≥97% (HPLC);KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2;Cecropin B (Platysamiacecropia antibacterial peptide) (9CI);LYS-TRP-LYS-VAL-PHE-LYS-LYS-ILE-GLU-LYS-MET-GLY-ARG-ASN-ILE-ARG-ASN-GLY-ILE-VAL-LYS-ALA-GLY-PRO-ALA-ILE-ALA-VAL-LEU-GLY-GLU-ALA-LYS-ALA-LEU-NH2;H-LYS-TRP-LYS-VAL-PHE-LYS-LYS-ILE-GLU-LYS-MET-GLY-ARG-ASN-ILE-ARG-ASN-GLY-ILE-VAL-LYS-ALA-GLY-PRO-ALA-ILE-ALA-VAL-LEU-GLY-GLU-ALA-LYS-ALA-LEU-NH2;Cecropin B H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
- CBNumber
- CB9416488
- Molecular Formula
- C176H302N52O41S
- Formula Weight
- 3834.66988
- MOL File
- 80451-05-4.mol
CECROPIN B Property
- storage temp.
- −20°C
- form
- powder
- color
- White to off-white
- Water Solubility
- Water : 20 mg/mL (5.22 mM)
- Sequence
- H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
Safety
- WGK Germany
- 3
N-Bromosuccinimide Price
- Product number
- C1796
- Product name
- Cecropin B
- Purity
- ≥97% (HPLC), powder
- Packaging
- 0.1mg
- Price
- $243
- Updated
- 2025/07/31
- Product number
- C364848
- Product name
- Cecropin B
- Packaging
- 1mg
- Price
- $130
- Updated
- 2021/12/16
- Product number
- C364848
- Product name
- Cecropin B
- Packaging
- 2.5mg
- Price
- $265
- Updated
- 2021/12/16
- Product number
- C2592B
- Product name
- Cecropin B
- Packaging
- 1mg
- Price
- $531
- Updated
- 2021/12/16
- Product number
- FC73321
- Product name
- Cecropin B
- Packaging
- 100ug
- Price
- $63
- Updated
- 2021/12/16
CECROPIN B Chemical Properties,Usage,Production
Uses
Cecropin B is an antibacterial peptide isolated from pig intestine and moths.
Biological Activity
Antibacterial peptide originally identified in moths (Hyalophora cecropia) and later in pig intestine.', 'Cecropin B is known for its antimicrobial activity. It displays antitumor effects in hepatocellular carcinoma, lymphoma, and leukemia cell lines.
in vivo
The wounds are moist with more exudation in C group, while that in other groups are dry without obvious exudation. The body temperature of the majority of the mice in each group is elevated, but the number of leucocytes in each group is lowered after operation. The quantity of bacteria in muscle in A group is obviously lower than that in M group and C group. The number of surviving mice after 4 PID in C group is evidently smaller than that in A and M groups( P<0. 05)[2].
IC 50
CYP3
CECROPIN B Preparation Products And Raw materials
Raw materials
Preparation Products
CECROPIN B Suppliers
- Tel
- 21-61263452 13641803416
- Fax
- 86-21-61263399
- ymbetter@glbiochem.com
- Country
- China
- ProdList
- 9981
- Advantage
- 64
- Tel
- 021-54306202 13764082696
- info@hanhongsci.com
- Country
- China
- ProdList
- 42934
- Advantage
- 64
- Tel
- 021-50135380
- shchemsky@sina.com
- Country
- China
- ProdList
- 15402
- Advantage
- 60
- Tel
- 0411-62910999 13889544652
- sales@meilune.com
- Country
- China
- ProdList
- 4747
- Advantage
- 58
- Tel
- 021-58950125
- Fax
- (86) 21-58955996
- info@chemexpress.com
- Country
- China
- ProdList
- 7552
- Advantage
- 61
- Tel
- 020-39119399 18927568969
- Fax
- 020-39119999
- isunpharm@qq.com
- Country
- China
- ProdList
- 4720
- Advantage
- 55
- Tel
- 0510-85629785 18013409632
- Fax
- 051085625359
- sales@reading-chemicals.com
- Country
- China
- ProdList
- 15178
- Advantage
- 58
- Tel
- 86-574-27787657
- Fax
- 86-574-27912196
- info@dearchem.com
- Country
- China
- ProdList
- 4613
- Advantage
- 58
- Tel
- 021-60345187 13671753212
- Fax
- 021-34702061
- lzz841106@aliyun.com
- Country
- China
- ProdList
- 10263
- Advantage
- 55
- Tel
- 021-61478794
- Fax
- 021-61478794
- sales@hcshhai.com
- Country
- China
- ProdList
- 9793
- Advantage
- 50
- Tel
- +86 (21) 61124340
- Fax
- +86 (21) 6129-4103
- Country
- China
- ProdList
- 9756
- Advantage
- 58
- Tel
- 0571-89197072; 18668118770
- Fax
- 0571-89197072
- linda@peptide-china.com
- Country
- China
- ProdList
- 235
- Advantage
- 56
- Tel
- +86-21-5821 5861
- Fax
- +86-21-5106 2861
- sales@letopharm.com
- Country
- China
- ProdList
- 2384
- Advantage
- 58
- Tel
- 18620099427
- Fax
- +86-20-62619665
- amy@howeipharm.com
- Country
- China
- ProdList
- 6687
- Advantage
- 55
- Tel
- 021-52907766-8042
- Fax
- 021-52906523
- Country
- China
- ProdList
- 9941
- Advantage
- 58
- Tel
- 021-61312847; 18021002903
- Fax
- QQ:3008007432
- 3008007409@qq.com
- Country
- China
- ProdList
- 71826
- Advantage
- 60
- Tel
- 4009903999 13395398332
- Fax
- 0539-6365991
- sales@xiyashiji.com
- Country
- China
- ProdList
- 20794
- Advantage
- 60
- Tel
- 400-1166-196 15982826727
- Fax
- QQ:800101999
- cdhxsj@163.com
- Country
- China
- ProdList
- 14603
- Advantage
- 60
- Tel
- 010-60605840 18892239720
- Fax
- 010-60605840
- psaitong@jm-bio.com
- Country
- China
- ProdList
- 12306
- Advantage
- 58
- Tel
- 17705183659
- Fax
- 84523390
- sales@njleonbiotech.com
- Country
- China
- ProdList
- 5501
- Advantage
- 55
- Tel
- 025-58361106-805 15951641583
- Fax
- 025-58361106-806
- zhao.xu@njpeptide.com
- Country
- China
- ProdList
- 9979
- Advantage
- 55
- Tel
- 0512-56316828
- Fax
- 0512-56316826
- info@amateksci.com
- Country
- China
- ProdList
- 28785
- Advantage
- 58
- Tel
- 400-400-1332688 18019345275
- Fax
- 400-133-2688
- amy@rhawn.cn
- Country
- China
- ProdList
- 14948
- Advantage
- 58
- Tel
- 0571-87213919
- Eric@peptidego.com
- Country
- China
- ProdList
- 7408
- Advantage
- 58
- Tel
- 4009004166/18616739031 18616739031
- 3007523370@qq.com
- Country
- China
- ProdList
- 52687
- Advantage
- 58
- Tel
- 15911056312
- liming@bio-fount.com
- Country
- China
- ProdList
- 9729
- Advantage
- 58
- Tel
- +1-2135480471
- sales@sarms4muscle.com
- Country
- China
- ProdList
- 10473
- Advantage
- 58
- Tel
- +86-027-59207850 +86-13986145403;
- Fax
- 86-27-59524646
- info@fortunachem.com
- Country
- China
- ProdList
- 5987
- Advantage
- 58
- Tel
- 0571-88211921
- sales1@gotopbio.com
- Country
- CHINA
- ProdList
- 2609
- Advantage
- 58
- Tel
- +86-0371-86658258 +8613203830695
- Fax
- 0371-86658258
- laboratory@coreychem.com
- Country
- China
- ProdList
- 30229
- Advantage
- 58
- Tel
- 021-61263389 13524856427
- Fax
- WeChat630417570
- Joetang@glschina.com
- Country
- China
- ProdList
- 10000
- Advantage
- 58
- Tel
- 0551-65326643 18156095617
- Fax
- 0551-65326641
- info@cellmano.com
- Country
- China
- ProdList
- 995
- Advantage
- 58
- Tel
- 021-021-61998551 13122364865
- sale1@shzysw.net
- Country
- China
- ProdList
- 9778
- Advantage
- 58
- Tel
- 19850819832
- 2173594524@qq.com
- Country
- China
- ProdList
- 2638
- Advantage
- 58
- Tel
- 021-61263455 13167021076
- amy@glschina.com
- Country
- China
- ProdList
- 9736
- Advantage
- 58
- Tel
- 13758194781 13173652190
- 522013271@qq.com
- Country
- China
- ProdList
- 2395
- Advantage
- 58
- Tel
- 0510-85629785 18013409632
- Fax
- 0510-85625359
- sales@reading-chemicals.com
- Country
- China
- ProdList
- 14081
- Advantage
- 58
- Tel
- 18115476705
- sales@tgpeptide.com
- Country
- China
- ProdList
- 3058
- Advantage
- 58
- Tel
- 0571-88760729 18072970094
- supports@ontorespeptide.com
- Country
- China
- ProdList
- 2696
- Advantage
- 58
- Tel
- 15397062932
- sales1@gotopbio.com
- Country
- China
- ProdList
- 2923
- Advantage
- 58
- Tel
- 027-027-59308705 18871579363
- Fax
- 027-59308705
- 1248680011@qq.com
- Country
- China
- ProdList
- 9850
- Advantage
- 58
- Tel
- 027-027-59223025 15107168801
- Fax
- 027-59223025
- 1718480011@qq.com
- Country
- China
- ProdList
- 9719
- Advantage
- 58
- Tel
- 027-027-59210159 15377098680
- Fax
- 027-59210159
- 1148280011@qq.com
- Country
- China
- ProdList
- 9835
- Advantage
- 58
- Tel
- 010-60605840 15801484223;
- psaitong@jm-bio.com
- Country
- China
- ProdList
- 29757
- Advantage
- 58
- Tel
- 021-58690851 15690882017
- 1877080091@qq.com
- Country
- China
- ProdList
- 7521
- Advantage
- 58
- Tel
- 400-1647117 13681763483
- product02@bidepharm.com
- Country
- China
- ProdList
- 59936
- Advantage
- 58
- Tel
- 13675144456
- alan.chow@synzest.com
- Country
- China
- ProdList
- 9470
- Advantage
- 58
- Tel
- 17711399154
- 3211919385@qq.com
- Country
- China
- ProdList
- 1815
- Advantage
- 58
- Tel
- 0571-0571-88211921 19105816207
- sales4@gotopbio.com
- Country
- China
- ProdList
- 5144
- Advantage
- 58
- Tel
- 4008200310
- marketing@tsbiochem.com
- Country
- China
- ProdList
- 24961
- Advantage
- 58
View Lastest Price from CECROPIN B manufacturers
- Product
- Cecropin B 80451-05-4
- Price
- US $0.10-0.30/kg
- Min. Order
- 1kg
- Purity
- >98%
- Supply Ability
- 20 tons
- Release date
- 2024-01-12