CJC1295

ChemicalBook > CAS DataBase List > CJC1295

Product Name: CJC1295
CAS No.: 863288-34-0
Chemical Name: CJC1295
Synonyms: CJC-1295 Acetate;CJC1295;CJC Dac;CJC1295 DCA;CJC-1295(2MG);sarms CJC1295;CJC-1295(10mg);CJC 1295 w/o DAC;CJC-1295 CJC-1295;CJC1295 with out DAC
CBNumber: CB01470921
Molecular Formula: C152H252N44O42
Formula Weight: 3367.89688
MOL File: 863288-34-0.mol

Less

CJC1295 Property

Melting point:: > 177° C (dec.)
Density: 1.45
storage temp.: -20°C Freezer, Under inert atmosphere
solubility: Ethanol (Slightly, Heated, Sonicated), Methanol (Slightly), Water (Slightly)
form: Solid
color: White to Off-White
InChI: InChI=1S/C152H252N44O42/c1-22-79(15)118(194-125(214)84(20)171-135(224)107(68-115(206)207)181-124(213)81(17)169-126(215)91(155)65-87-41-45-89(201)46-42-87)147(236)189-106(66-86-34-25-24-26-35-86)141(230)196-120(85(21)200)149(238)180-99(51-54-114(158)205)132(221)190-111(72-199)145(234)185-105(67-88-43-47-90(202)48-44-88)140(229)178-96(40-33-59-168-152(164)165)128(217)177-94(37-28-30-56-154)133(222)193-117(78(13)14)146(235)187-100(60-73(3)4)134(223)170-82(18)123(212)175-97(49-52-112(156)203)130(219)183-103(63-76(9)10)138(227)191-109(70-197)143(232)172-83(19)122(211)174-95(39-32-58-167-151(162)163)127(216)176-93(36-27-29-55-153)129(218)182-102(62-75(7)8)137(226)184-101(61-74(5)6)136(225)179-98(50-53-113(157)204)131(220)186-108(69-116(208)209)142(231)195-119(80(16)23-2)148(237)188-104(64-77(11)12)139(228)192-110(71-198)144(233)173-92(121(159)210)38-31-57-166-150(160)161/h24-26,34-35,41-48,73-85,91-111,117-120,197-202H,22-23,27-33,36-40,49-72,153-155H2,1-21H3,(H2,156,203)(H2,157,204)(H2,158,205)(H2,159,210)(H,169,215)(H,170,223)(H,171,224)(H,172,232)(H,173,233)(H,174,211)(H,175,212)(H,176,216)(H,177,217)(H,178,229)(H,179,225)(H,180,238)(H,181,213)(H,182,218)(H,183,219)(H,184,226)(H,185,234)(H,186,220)(H,187,235)(H,188,237)(H,189,236)(H,190,221)(H,191,227)(H,192,228)(H,193,222)(H,194,214)(H,195,231)(H,196,230)(H,206,207)(H,208,209)(H4,160,161,166)(H4,162,163,167)(H4,164,165,168)/t79-,80-,81+,82-,83-,84-,85+,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,117-,118-,119-,120-/m0/s1
InChIKey: XOZMWINMZMMOBR-HRDSVTNWSA-N
SMILES: O=C([C@]([H])(C([H])([H])C([H])(C([H])([H])[H])C([H])([H])[H])N([H])C([C@]([H])(C([H])([H])C([H])([H])C([H])([H])C([H])([H])N([H])[H])N([H])C([C@]([H])(C([H])([H])C([H])([H])C([H])([H])N([H])/C(=N/[H])/N([H])[H])N([H])C([C@]([H])(C([H])([H])[H])N([H])C([C@]([H])(C([H])([H])O[H])N([H])C([C@]([H])(C([H])([H])C([H])(C([H])([H])[H])C([H])([H])[H])N([H])C([C@]([H])(C([H])([H])C([H])([H])C(N([H])[H])=O)N([H])C([C@]([H])(C([H])([H])[H])N([H])C([C@]([H])(C([H])([H])C([H])(C([H])([H])[H])C([H])([H])[H])N([H])C([C@]([H])(C([H])(C([H])([H])[H])C([H])([H])[H])N([H])C([C@]([H])(C([H])([H])C([H])([H])C([H])([H])C([H])([H])N([H])[H])N([H])C([C@]([H])(C([H])([H])C([H])([H])C([H])([H])N([H])/C(=N/[H])/N([H])[H])N([H])C([C@]([H])(C([H])([H])C1C([H])=C([H])C(=C([H])C=1[H])O[H])N([H])C([C@]([H])(C([H])([H])O[H])N([H])C([C@]([H])(C([H])([H])C([H])([H])C(N([H])[H])=O)N([H])C([C@]([H])([C@@]([H])(C([H])([H])[H])O[H])N([H])C([C@]([H])(C([H])([H])C1C([H])=C([H])C([H])=C([H])C=1[H])N([H])C([C@]([H])([C@@]([H])(C([H])([H])[H])C([H])([H])C([H])([H])[H])N([H])C([C@]([H])(C([H])([H])[H])N([H])C([C@]([H])(C([H])([H])C(=O)O[H])N([H])C([C@@]([H])(C([H])([H])[H])N([H])C([C@]([H])(C([H])([H])C1C([H])=C([H])C(=C([H])C=1[H])O[H])N([H])[H])=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)N([H])[C@]([H])(C(N([H])[C@]([H])(C(N([H])[C@@]([H])(C([H])([H])C(=O)O[H])C(N([H])[C@]([H])(C(N([H])[C@]([H])(C(N([H])[C@]([H])(C(N([H])[C@]([H])(C(N([H])[H])=O)C([H])([H])C([H])([H])C([H])([H])N([H])/C(=N/[H])/N([H])[H])=O)C([H])([H])O[H])=O)C([H])([H])C([H])(C([H])([H])[H])C([H])([H])[H])=O)[C@@]([H])(C([H])([H])[H])C([H])([H])C([H])([H])[H])=O)=O)C([H])([H])C([H])([H])C(N([H])[H])=O)=O)C([H])([H])C([H])(C([H])([H])[H])C([H])([H])[H]

Less

Hazard and Precautionary Statements (GHS)

Symbol(GHS)

Signal word

Danger

Hazard statements

H314Causes severe skin burns and eye damage

H318Causes serious eye damage

Precautionary statements

P280Wear protective gloves/protective clothing/eye protection/face protection.

P301+P330+P331IF SWALLOWED: Rinse mouth. Do NOT induce vomiting.

P302+P352IF ON SKIN: wash with plenty of soap and water.

P304+P340IF INHALED: Remove victim to fresh air and Keep at rest in a position comfortable for breathing.

P305+P351+P338IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continuerinsing.

P310Immediately call a POISON CENTER or doctor/physician.

Less

CJC1295 Chemical Properties,Usage,Production

Description

CJC-1295 is an incredibly effective growth hormone and works by causing another substance to be secreted. It stimulates the release of your own body’s growth hormone which. Research show that after the age of 30 the body’s growth hormone level drops quickly and approximately 15% every 10 years. CJC-1295 is able to increase growth hormone naturally by binding to receptors for growth hormone releasing hormone (GHRH) on your brain and more specifically the pituitary gland.

Uses

CJC 1295 Acetate is used in application of growth hormone releasing hormone agonist to preparing anti-aging agent.

benefits

CJC1295 is a chemically synthesised peptide that significantly promotes the release of growth hormone by activating the pituitary gland. Receiving CJC-1295 peptide therapy has multiple benefits, including: increased metabolism and energy, decreased body fat and increased muscle mass, optimised immune system, improved bone density, improved sleep, shorter recovery time, repair of injuries, improved skin elasticity, reduced wrinkles, strengthened nails and hair, and more.

Pharmacology

By doing this it triggers the brain to release growth hormone that would have otherwise been lost with age. Research completed with healthy men and women between the ages of 21 and 61, showed that CJC-1295 had the ability to increase serum growth hormone levels by 200-1000%. In these individuals, the elevated growth hormone production and release continued for up to 6 days because CJC-1295 has a half life of about 6-8 days. This longer half-life means the body continues to produces beyond the day of injection and is thought to be a great benefit has compared to other peptides that also have similar actions. For this reason and a few more, CJC-1295 has become very effective peptide for safely increasing growth hormone levels.

Clinical Use

CJC 1295 allows the anterior pituitary to follow the natural, pulsatile release of growth hormone without an increase in appetite stimulation, cortisol, acetylcholine, prolactin, and aldosterone. Typically, you will see CJC compounded with Ipamorelin due to its ability to stimulate GHRH for enhanced results.Increased GH secretion and IFG-1 levels;Increased muscle growth;Increased bone density;Improved cognitive function and memory;Increased cellular repair and regeneration;Increased fat loss;Taken before bed to maximize the natural cycle of growth hormone.

Side effects

CJC-1295 is safely biologically increased growth hormone levels without the side of effects of other medication such hGH treatment which have been none to have more side effects. Some of the side effects of CJC-1295 are generally mild and tend to not last long if at all such as headache, flushing, and dizziness. The most common reported side effect is redness and irritation at the injection site.

CJC1295 Preparation Products And Raw materials

Raw materials

Preparation Products

Less

CJC1295 Suppliers

China 153 China Hong Kong 1 India 4 United States 2 Global 160

Shanghai Boyle Chemical Co., Ltd.

Tel
Fax: 86-21-57758967
Email: sales@boylechem.com
Country: China
ProdList: 2922
Advantage: 55

Cellmano Biotech Limited

Tel: 0551-65326643 18156095617
Fax: 0551-65326641
Email: info@cellmano.com
Country: China
ProdList: 1011
Advantage: 55

Beijing HuaMeiHuLiBiological Chemical

Tel: 010-56205725
Fax: 010-65763397
Email: waley188@sohu.com
Country: China
ProdList: 12335
Advantage: 58

Shanghai T&W Pharmaceutical Co., Ltd.

Tel: +86 21 61551611
Fax: +86 21 50676805
Country: China
ProdList: 9891
Advantage: 58

Shanghai Witofly Chemical Co.,Ltd

Tel
Email: sales@witofly.com
Country: China
ProdList: 2864
Advantage: 52

Nanjing Sunlida Biological Technology Co., Ltd.

Tel: 025-57798810
Fax: 025-57019371
Email: sales@sunlidabio.com
Country: China
ProdList: 3239
Advantage: 55

Wuxi Zhongkun Biochemical Technology Co., Ltd.

Tel: 0510-85629785 18013409632
Fax: 051085625359
Email: sales@reading-chemicals.com
Country: China
ProdList: 15178
Advantage: 58

Credit Asia Chemical Co., Ltd.

Tel: +86 (21) 61124340
Fax: +86 (21) 6129-4103
Country: China
ProdList: 9756
Advantage: 58

Avantpbc Chemical Tech(Shanghai) Co,Ltd.

Tel: 17802107445
Country: China
ProdList: 185
Advantage: 55

Shanghai Chaolan Chemical Technology Center

Tel: 021-QQ：65489617 15618227136
Fax: 21-5161 9052
Email: Sales@ATKchemical.com
Country: China
ProdList: 7295
Advantage: 58

Shenzhen Simeiquan Biotechnology Co. Ltd

Tel: 18126413629 0755-23311925 2355327053
Fax: 0755-23311925
Email: abel@ycgmp.com
Country: China
ProdList: 5113
Advantage: 58

Amadis Chemical Company Limited

Tel: 571-89925085
Fax: 0086-571-89925065
Email: sales@amadischem.com
Country: China
ProdList: 131957
Advantage: 58

Beijing Jin Ming Biotechnology Co., Ltd.

Tel: 010-60605840 18892239720
Fax: 010-60605840
Email: psaitong@jm-bio.com
Country: China
ProdList: 12306
Advantage: 58

Shenzhen Sendi Biological Technology Co., Ltd.

Tel: 18124570582 TEL：0755-23574479 2355327139
Fax: 0755-23229476 QQ: 2355327139
Email: siliao02@yccreate.com
Country: China
ProdList: 6116
Advantage: 58

Shanghai Biopharmaleader Co., Ltd.

Tel: +86 18721201413
Fax: +86 (21) 5775-8967
Email: sales@biopharmaleader.com
Country: China
ProdList: 1720
Advantage: 58

Chengdu Youngshe Chemical Co., Ltd.

Tel: +86-17380623303 +86-17380623303
Fax: 028-62328193
Email: Caroline@youngshechem.com
Country: China
ProdList: 4811
Advantage: 58

Shanghai Mokay Pharmaceutical Technology Co., Ltd.

Tel: 021-60257269 18601606476
Fax: +86-21-60253672
Email: yl@mkpharma.cn
Country: China
ProdList: 206
Advantage: 58

Zhuhai JiaYi Biological Technology Co., Ltd.

Tel: 18578209868 2355327026
Fax: 18578209868 QQ：2355327026
Email: steroidbest@hotmail.com
Country: China
ProdList: 6501
Advantage: 58

Twochem Co.Ltd.

Tel: 021-58111628 15800915896
Fax: QQ 3285589261
Email: sales@twochem.com
Country: China
ProdList: 1788
Advantage: 58

Shanghai Chain peptide Biological Co., Ltd.

Tel: +86 18516118859
Fax: +86 (21) 2096 2272
Email: sales@chainpeptide.com
Country: CHINA
ProdList: 419
Advantage: 58

Sichuan Jisheng Biopharmaceutical Co.,Ltd.

Tel: +86-0833-2598983 +86-18086877136
Fax: +86-833-2598903
Email: Nyx-peptide@jsjpharm.cn
Country: China
ProdList: 309
Advantage: 58

Nanjing crow LuNing pharmaceutical technology co., LTD

Tel: 13382066392
Country: CHINA
ProdList: 4877
Advantage: 58

Guangzhou Belka Biological Technology Co., Ltd.

Tel: +86-18665676617
Fax: 18665676617
Country: China
ProdList: 957
Advantage: 58

ANHUI WITOP BIOTECH CO., LTD

Tel: +8615255079626
Email: eric@witopchemical.com
Country: China
ProdList: 23541
Advantage: 58

Hong Kong Excellence Biotechnology Co., Ltd.

Tel
Fax: wickrme：chemical888
Email: ada@sh-teruiop.com
Country: China
ProdList: 875
Advantage: 58

Hebei Mojin Biotechnology Co., Ltd

Tel: +86 13288715578 +8613288715578
Email: sales@hbmojin.com
Country: China
ProdList: 12833
Advantage: 58

Zhejiang J&C Biological Technology Co.,Limited

Tel: +1-2135480471 +1-2135480471
Email: sales@sarms4muscle.com
Country: China
ProdList: 10473
Advantage: 58

Wuhan wingroup Pharmaceutical Co., Ltd

Tel: +86-13296627870; +8613296627870
Fax: 0086-27-87819568
Email: info@whwingroup.com
Country: China
ProdList: 695
Advantage: 58

Hefei TNJ Chemical Industry Co.,Ltd.

Tel: +86-0551-65418684 +8618949823763
Fax: 0086-551-65418684
Email: sales@tnjchem.com
Country: China
ProdList: 25356
Advantage: 58

Guangzhou TongYi biochemistry technology Co.,LTD

Tel: +8613073028829
Email: mack@tongyon.com
Country: China
ProdList: 2994
Advantage: 58

Wuhan Demeikai Biotechnology Co., Ltd

Tel: +8618942921723
Email: info@dmksw.xin
Country: China
ProdList: 717
Advantage: 58

Wuhan Golt Biotech Co., Ltd.

Tel: +8615389281203
Email: maria@goltbiotech.com
Country: China
ProdList: 970
Advantage: 58

Hebei Qige Biological Technology Co. Ltd

Tel: +86 +8618733132031
Country: CHINA
ProdList: 1303
Advantage: 58

Shijiazhuang Tongyang Import and Export Co., LTD

Tel: 18031361688;
Email: admin@sjztongyang.com
Country: China
ProdList: 977
Advantage: 58

Zhuoer Chemical Co., Ltd

Tel: 02120970332; +8613524231522
Fax: +86-21-58816016
Email: sales@zhuoerchem.com
Country: China
ProdList: 2904
Advantage: 58

Baoji Guokang Healthchem co.,ltd

Tel: +8615604608665 15604608665
Email: dominicguo@gk-bio.com
Country: CHINA
ProdList: 9414
Advantage: 58

Hebei Zhanyao Biotechnology Co. Ltd

Tel: 15369953316 +8615369953316
Email: admin@zhanyaobio.com
Country: China
ProdList: 2123
Advantage: 58

Cangzhou Wanyou New Material Technology Co.,Ltd

Tel: 18631714998
Email: sales@czwytech.com
Country: CHINA
ProdList: 904
Advantage: 58

Beijing Yibai Biotechnology Co., Ltd

Tel: 0086-182-6772-3597
Email: sales04@yibaibiotech.com
Country: CHINA
ProdList: 419
Advantage: 58

Shanghai Longyu Biotechnology Co., Ltd.

Tel: +8619521488211
Fax: +86 15821988213
Email: info@longyupharma.com
Country: China
ProdList: 2542
Advantage: 58

Chongqing Chemdad Co., Ltd

Tel: +86-023-6139-8061 +86-86-13650506873
Email: sales@chemdad.com
Country: China
ProdList: 39894
Advantage: 58

Wuhan Xinru Chemical Co., Ltd.

Tel: 15927387915 15337108568
Email: 2769903731@qq.com
Country: China
ProdList: 3336
Advantage: 58

Hangzhou Xinhai Pharmaceutical Technology Co., Ltd.

Tel: 0571-86758863 13867485072
Fax: 0571-86758863
Email: lulu@thinheal.com
Country: China
ProdList: 302
Advantage: 58

CONIER CHEM AND PHARMA LIMITED

Tel: +8618523575427
Email: sales@conier.com
Country: China
ProdList: 49374
Advantage: 58

Nanjing chengqimei Biotechnology Co., Ltd

Tel: 19850819832
Email: 2173594524@qq.com
Country: China
ProdList: 2638
Advantage: 58

Nantong puyue biomedical Co., Ltd

Tel: 0513-0513-0513-89158300 18014392889
Fax: 0513-89158198
Email: sales@puyerbiopharma.com
Country: China
ProdList: 4677
Advantage: 58

Shanghai Jiuqu Biotechnology Co., Ltd.

Tel: 17821436236
Email: 3203543846@qq.com
Country: CHINA
ProdList: 140
Advantage: 58

Wuxi Helen Biotechnology Co., Ltd.,

Tel: 0510-85629785 18013409632
Fax: 0510-85625359
Email: sales@reading-chemicals.com
Country: China
ProdList: 14081
Advantage: 58

Shanghai Hewu Biotechnology Co., LTD

Tel: 021-57886085 17317861055
Email: shhebio@126.com
Country: CHINA
ProdList: 7974
Advantage: 58

Wuhan Wiseman Bioengineering Co.,Ltd

Tel: 027-59506022 13419526507
Fax: 027-59506022
Email: 13419526507@163.com
Country: China
ProdList: 2985
Advantage: 58

Less

View Lastest Price from CJC1295 manufacturers

Hebei Zhuanglai Chemical Trading Co.,Ltd

Product: CJC-1295 863288-34-0
Price: US $10.00/box
Min. Order: 1box
Purity: 99%
Supply Ability: 20ton
Release date: 2024-05-11

Hebei Zhuanglai Chemical Trading Co.,Ltd

Product: CJC-1295 Without DAC 863288-34-0
Price: US $50.00/box
Min. Order: 1box
Purity: 99%
Supply Ability: 5000boxes
Release date: 2024-05-11

Hebei Jiafan Trading Company Limited

Product: CJC-1295 without DAC 5mg + IPA 5mg 863288-34-0
Price: US $5.00/box
Min. Order: 1box
Purity: 99.99%
Supply Ability: 10000 bottles
Release date: 2024-12-23

863288-34-0, CJC1295Related Search:

Pralmorelin Oxytocin Cetrorelix acetate motilin-related peptide Phosphorus trichloride Trifluoroacetic acid Potassium pyrophosphate Dimethyl fumarate Cinnamaldehyde Sodium sulfide L-Lysine BUSERELIN Melanotan II BPC 157 Melanotan 1 Ipamorelin Somatostatin Hexarelin

CJC1295

Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2

L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide

CJC-1295 CJC-1295

CJC-1295 Acetate

CJC1295 with out DAC

-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl

CJC-1295(2MG)

CJC-1295(10mg)

CJC-1295 Without DAC 86328-34-0

CJC-1295 Acetate without DAC

Peptides Bodybuilding cjc-1295

Human Growth Peptide Cjc 1295 with Dac/Cjc 1295 Without Dac 2mg/Vials

CJC1295 No DAC acetate

CJC 1295 w/o DAC

CJC1295 with DAC, MK677, Melanotan 2, huperzine A, minoxidil sulfate, RU58841, SAG

sarms CJC1295

CJC-1295 Whitout DAC/CJC-1295 DAC/CJC-1295

CJC1295 DCA

CJC-1295(DAC/Without DAC)

CJC Dac

CJC-1295 without DAC 5mg + IPA 5mg

863288-34-0

156-1-5

86328-34-0

C159H258N46O45

Peptides

CJC

863288-34-0