APELIN-36 (HUMAN)
- Product Name
- APELIN-36 (HUMAN)
- CAS No.
- 252642-12-9
- Chemical Name
- APELIN-36 (HUMAN)
- Synonyms
- Apelin (human);Apelin-36 (tfa);APELIN-36 (HUMAN);Apelin-36|Apelin(human);Apelin-36, human - 1 mg;Apelin 36 (human) TFA salt;M.W. 4195.83 C184H297N69O43S;LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF;H-LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF-OH;Apelin 36 (human), Endogenous apelin receptor (APJ) agonist
- CBNumber
- CB1688041
- Molecular Formula
- C184H295N69O42R2S
- Formula Weight
- 4177.8132
- MOL File
- 252642-12-9.mol
APELIN-36 (HUMAN) Property
- storage temp.
- -15°C
- solubility
- DMF: 30 mg/ml; DMSO: 30 mg/ml; Ethanol: 10 mg/ml; PBS (pH 7.2): 10 mg/ml
- form
- Lyophilized powder
- color
- White to off-white
- Water Solubility
- Soluble in water at 1mg/ml
- Sequence
- Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe
N-Bromosuccinimide Price
- Product number
- 13524
- Product name
- Apelin-36
- Purity
- ≥95%
- Packaging
- 500μg
- Price
- $199
- Updated
- 2024/03/01
- Product number
- 13524
- Product name
- Apelin-36
- Purity
- ≥95%
- Packaging
- 1mg
- Price
- $378
- Updated
- 2024/03/01
- Product number
- 13524
- Product name
- Apelin-36
- Purity
- ≥95%
- Packaging
- 5mg
- Price
- $1583
- Updated
- 2024/03/01
- Product number
- 2426
- Product name
- Apelin-36, human
- Packaging
- 1
- Price
- $480
- Updated
- 2021/12/16
- Product number
- FA109395
- Product name
- Apelin-36 (human) H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH
- Packaging
- 500ug
- Price
- $425
- Updated
- 2021/12/16
APELIN-36 (HUMAN) Chemical Properties,Usage,Production
Uses
Apelin-36(human) is an endogenous orphan G protein-coupled receptor APJ agonist, with an EC50 of 20 nM. Apelin-36(human) shows high affinity to human APJ receptors expressed in HEK 293 cells (pIC50=8.61). Apelin-36 has been linked to two major types of biological activities: cardiovascular and metabolic. Apelin-36(human) inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ[1][2][3][4].
IC 50
HIV-1; HIV-2
storage
Store at -20°C
References
[1] Tatemoto K, Hosoya M, Habata Y, et al. Isolation and characterization of a novel endogenous peptide ligand for the human APJ receptor. Biochem Biophys Res Commun. 1998;251(2):471-476. DOI:10.1006/bbrc.1998.9489
[2] Medhurst AD, Jennings CA, Robbins MJ, et al. Pharmacological and immunohistochemical characterization of the APJ receptor and its endogenous ligand apelin. J Neurochem. 2003;84(5):1162-1172. DOI:10.1046/j.1471-4159.2003.01587.x
[3] Zou MX, Liu HY, Haraguchi Y, Soda Y, Tatemoto K, Hoshino H. Apelin peptides block the entry of human immunodeficiency virus (HIV). FEBS Lett. 2000;473(1):15-18. DOI:10.1016/s0014-5793(00)01487-3
[4] Galon-Tilleman H, Yang H, Bednarek MA, et al. Apelin-36 Modulates Blood Glucose and Body Weight Independently of Canonical APJ Receptor Signaling. J Biol Chem. 2017;292(5):1925-1933. DOI:10.1074/jbc.M116.748103
APELIN-36 (HUMAN) Preparation Products And Raw materials
Raw materials
Preparation Products
APELIN-36 (HUMAN) Suppliers
- Tel
- 821-50328103-801 18930552037
- Fax
- 86-21-50328109
- 3bsc@sina.com
- Country
- China
- ProdList
- 15838
- Advantage
- 69
- Tel
- 21-61263452 13641803416
- Fax
- 86-21-61263399
- ymbetter@glbiochem.com
- Country
- China
- ProdList
- 9981
- Advantage
- 64
- Tel
- 025-83697070 13913916777;
- Fax
- +86-25-83453306
- info@chemlin.com.cn
- Country
- China
- ProdList
- 15778
- Advantage
- 64
- Tel
- 021-54306202 13764082696
- info@hanhongsci.com
- Country
- China
- ProdList
- 42934
- Advantage
- 64
- Tel
- 021-50135380
- shchemsky@sina.com
- Country
- China
- ProdList
- 32321
- Advantage
- 50
- Tel
- 0551-65326643 18156095617
- Fax
- 0551-65326641
- info@cellmano.com
- Country
- China
- ProdList
- 1010
- Advantage
- 55
- Tel
- 0510-85629785 18013409632
- Fax
- 051085625359
- sales@reading-chemicals.com
- Country
- China
- ProdList
- 15178
- Advantage
- 58
- Tel
- 17705183659
- Fax
- 84523390
- sales@njleonbiotech.com
- Country
- China
- ProdList
- 5501
- Advantage
- 55
- Tel
- 025-58361106-805 15951641583
- Fax
- 025-58361106-806
- zhao.xu@njpeptide.com
- Country
- China
- ProdList
- 9979
- Advantage
- 55
- Tel
- +86-17380623303
- Fax
- 028-62328193
- Caroline@youngshechem.com
- Country
- China
- ProdList
- 4802
- Advantage
- 58
View Lastest Price from APELIN-36 (HUMAN) manufacturers
- Product
- APELIN-36 (HUMAN) 252642-12-9
- Price
- US $7.00/KG
- Min. Order
- 1KG
- Purity
- 99%
- Supply Ability
- 100KG
- Release date
- 2020-02-16