ADRENOMEDULLIN (22-52) (HUMAN)
- Product Name
- ADRENOMEDULLIN (22-52) (HUMAN)
- CAS No.
- 159899-65-7
- Chemical Name
- ADRENOMEDULLIN (22-52) (HUMAN)
- Synonyms
- TY-31-NH2;22-52-Human adrenomedullin;Human adrenomedullin(22-52);22-52-Adrenomedullin (human);ADRENOMEDULLIN (HUMAN, 22-52);ADRENOMEDULLIN (22-52) (HUMAN);Adrenomedullin (AM) (22-52), human;ADRENOMEDULLIN FRAGMENT 22-52 HUMAN;TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2;Adrenomedullin (22-52), human - 0.5 mg
- CBNumber
- CB8464169
- Molecular Formula
- C159H252N46O48
- Formula Weight
- 3575.98
- MOL File
- 159899-65-7.mol
ADRENOMEDULLIN (22-52) (HUMAN) Property
- Density
- 1.50±0.1 g/cm3(Predicted)
- storage temp.
- -20°C
- solubility
- Soluble in DMSO
- form
- Solid
- color
- White to off-white
- Sequence
- H-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2
Safety
- WGK Germany
- 3
- Storage Class
- 11 - Combustible Solids
N-Bromosuccinimide Price
- Product number
- A3832
- Product name
- Adrenomedullin Fragment 22-52 human
- Purity
- ≥97% (HPLC)
- Packaging
- 10μg
- Price
- $63.72
- Updated
- 2025/07/31
- Product number
- A3832
- Product name
- Adrenomedullin Fragment 22-52 human
- Purity
- ≥97% (HPLC)
- Packaging
- 50μg
- Price
- $202.5
- Updated
- 2025/07/31
- Product number
- FA109193
- Product name
- Adrenomedullin (22-52) (human) trifluoroacetate salt H-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 trifluoroacetate salt
- Packaging
- 500ug
- Price
- $295
- Updated
- 2021/12/16
- Product number
- FA73169
- Product name
- Adrenomedullin (22-52),human
- Packaging
- 500ug
- Price
- $325
- Updated
- 2021/12/16
- Product number
- 33037
- Product name
- Adrenomedullin(22-52)(human)trifluoroacetatesalt
- Packaging
- 1MG
- Price
- $419.33
- Updated
- 2021/12/16
ADRENOMEDULLIN (22-52) (HUMAN) Chemical Properties,Usage,Production
Uses
Adrenomedullin (AM) (22-52), human, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist, and also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat[1][2].
Biochem/physiol Actions
Adrenomedullin Fragment 22-52 [ADM22-52] is used as an adrenomedullin (ADM) receptor antagonist to study the functions and mechanism of action of ADM signaling. ADM(22-52) is used to differentiate adrenomedullin binding sites in various cells and tissues.
References
[1] Champion HC, et al. Adrenomedullin-(22-52) antagonizes vasodilator responses to CGRP but not adrenomedullin in the cat. Am J Physiol. 1997 Jan;272(1 Pt 2):R234-42. DOI:10.1152/ajpregu.1997.272.1.R234
[2] Ziolkowska A, et al. Effects of adrenomedullin and its fragment 22-52 on basal and ACTH-stimulated secretion of cultured rat adrenocortical cells. Int J Mol Med. 2003 May;11(5):613-5. PMID:12684698
ADRENOMEDULLIN (22-52) (HUMAN) Preparation Products And Raw materials
Raw materials
Preparation Products
ADRENOMEDULLIN (22-52) (HUMAN) Suppliers
- Tel
- 512-58900862 400-0707518
- Fax
- 0086-512-56765862
- sales@alabiochem.com
- Country
- China
- ProdList
- 972
- Advantage
- 59
- Tel
- 21-61263452 13641803416
- Fax
- 86-21-61263399
- ymbetter@glbiochem.com
- Country
- China
- ProdList
- 9981
- Advantage
- 64
- Tel
- 021-54306202 13764082696
- info@hanhongsci.com
- Country
- China
- ProdList
- 42934
- Advantage
- 64
- Tel
- 021-50135380
- shchemsky@sina.com
- Country
- China
- ProdList
- 32321
- Advantage
- 50
- Tel
- 0731-85526065 13308475853
- ivy@hnhbsj.com
- Country
- China
- ProdList
- 7247
- Advantage
- 62
- Tel
- 0551-65326643 18156095617
- Fax
- 0551-65326641
- info@cellmano.com
- Country
- China
- ProdList
- 1010
- Advantage
- 55
- Tel
- 400-6206333 13167063860
- Fax
- 021-50323701
- anhua.mao@aladdin-e.com
- Country
- China
- ProdList
- 25683
- Advantage
- 65
- Tel
- 0510-85629785 18013409632
- Fax
- 051085625359
- sales@reading-chemicals.com
- Country
- China
- ProdList
- 15178
- Advantage
- 58
- Tel
- 0571-89197072; 18668118770
- Fax
- 0571-89197072
- linda@peptide-china.com
- Country
- China
- ProdList
- 235
- Advantage
- 56
- Tel
- 021-61415566 800-8193336
- orderCN@merckgroup.com
- Country
- China
- ProdList
- 51395
- Advantage
- 80
View Lastest Price from ADRENOMEDULLIN (22-52) (HUMAN) manufacturers
- Product
- Adrenomedullin (22-52) (human) 159899-65-7
- Price
- US $0.10-0.30/kg
- Min. Order
- 1kg
- Purity
- ≥98.0%
- Supply Ability
- 20 tons
- Release date
- 2024-01-04
- Product
- ADRENOMEDULLIN (22-52) (HUMAN) 159899-65-7
- Price
- US $3.00/KG
- Min. Order
- 1KG
- Purity
- 99%
- Supply Ability
- 100kg
- Release date
- 2019-07-11