CECROPIN B
- Product Name
- CECROPIN B
- CAS No.
- 80451-05-4
- Chemical Name
- CECROPIN B
- Synonyms
- CECROPIN B;Aids096161;Aids-096161;Cecropin B - 0.5 mg;Cecropin B, ≥97% (HPLC);KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2;Cecropin B (Platysamiacecropia antibacterial peptide) (9CI);LYS-TRP-LYS-VAL-PHE-LYS-LYS-ILE-GLU-LYS-MET-GLY-ARG-ASN-ILE-ARG-ASN-GLY-ILE-VAL-LYS-ALA-GLY-PRO-ALA-ILE-ALA-VAL-LEU-GLY-GLU-ALA-LYS-ALA-LEU-NH2;H-LYS-TRP-LYS-VAL-PHE-LYS-LYS-ILE-GLU-LYS-MET-GLY-ARG-ASN-ILE-ARG-ASN-GLY-ILE-VAL-LYS-ALA-GLY-PRO-ALA-ILE-ALA-VAL-LEU-GLY-GLU-ALA-LYS-ALA-LEU-NH2;Cecropin B H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
- CBNumber
- CB9416488
- Molecular Formula
- C176H302N52O41S
- Formula Weight
- 3834.66988
- MOL File
- 80451-05-4.mol
CECROPIN B Property
- storage temp.
- −20°C
- form
- powder
- color
- White to off-white
- Water Solubility
- Water : 20 mg/mL (5.22 mM)
- Sequence
- H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
Safety
- WGK Germany
- 3
N-Bromosuccinimide Price
- Product number
- C1796
- Product name
- Cecropin B
- Purity
- ≥97% (HPLC), powder
- Packaging
- 0.1mg
- Price
- $243
- Updated
- 2025/07/31
- Product number
- C2592B
- Product name
- Cecropin B
- Packaging
- 1mg
- Price
- $531
- Updated
- 2021/12/16
- Product number
- C364848
- Product name
- Cecropin B
- Packaging
- 2.5mg
- Price
- $265
- Updated
- 2021/12/16
- Product number
- C364848
- Product name
- Cecropin B
- Packaging
- 1mg
- Price
- $130
- Updated
- 2021/12/16
- Product number
- FC108880
- Product name
- Cecropin B H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
- Packaging
- 250ug
- Price
- $132.5
- Updated
- 2021/12/16
CECROPIN B Chemical Properties,Usage,Production
Uses
Cecropin B is an antibacterial peptide isolated from pig intestine and moths.
Biological Activity
Antibacterial peptide originally identified in moths (Hyalophora cecropia) and later in pig intestine.', 'Cecropin B is known for its antimicrobial activity. It displays antitumor effects in hepatocellular carcinoma, lymphoma, and leukemia cell lines.
in vivo
The wounds are moist with more exudation in C group, while that in other groups are dry without obvious exudation. The body temperature of the majority of the mice in each group is elevated, but the number of leucocytes in each group is lowered after operation. The quantity of bacteria in muscle in A group is obviously lower than that in M group and C group. The number of surviving mice after 4 PID in C group is evidently smaller than that in A and M groups( P<0. 05)[2].
IC 50
CYP3
CECROPIN B Preparation Products And Raw materials
Raw materials
Preparation Products
CECROPIN B Suppliers
- Tel
- 021-58955995
- Fax
- 609-228-5909
- sales@medchemexpress.cn
- Country
- United States
- ProdList
- 4861
- Advantage
- 58
- Tel
- info@creative-peptides.com
- Country
- United States
- ProdList
- 6083
- Advantage
- 56
- Tel
- +1-800-259-7612
- Fax
- +1-800-259-7612
- info@musechem.com
- Country
- United States
- ProdList
- 4660
- Advantage
- 60
- Tel
- +1-631-485-4226
- Fax
- 1-631-614-7828
- inquiry@bocsci.com
- Country
- United States
- ProdList
- 19552
- Advantage
- 58
- Tel
- +1-781-999-5354;
- support@targetmol.com
- Country
- United States
- ProdList
- 39035
- Advantage
- 58
- Tel
- tp@aladdinsci.com
- Country
- United States
- ProdList
- 52923
- Advantage
- 58
- Tel
- --
- Fax
- --
- sales@waterstonetech.com
- Country
- United States
- ProdList
- 6786
- Advantage
- 30
- Tel
- --
- Fax
- --
- chemicals@usbio.net
- Country
- United States
- ProdList
- 6214
- Advantage
- 80
- Tel
- --
- Fax
- --
- sales@medchemexpress.com
- Country
- United States
- ProdList
- 6398
- Advantage
- 58
- Tel
- --
- Fax
- --
- Country
- United States
- ProdList
- 6773
- Advantage
- 87
- Tel
- --
- Fax
- --
- sales@aroztech.com
- Country
- United States
- ProdList
- 1877
- Advantage
- 30
- Tel
- --
- Fax
- --
- sales@3bsc.com
- Country
- United States
- ProdList
- 6718
- Advantage
- 47
- Tel
- --
- Fax
- --
- info@lktlabs.com
- Country
- United States
- ProdList
- 2164
- Advantage
- 64
- Tel
- --
- Fax
- --
- service@anaspec.com
- Country
- United States
- ProdList
- 4871
- Advantage
- 77
- Tel
- --
- Fax
- --
- sales@americanpeptide.com
- Country
- United States
- ProdList
- 1718
- Advantage
- 71
- Tel
- --
- Fax
- --
- sales@synpep.com
- Country
- United States
- ProdList
- 1943
- Advantage
- 51
- Tel
- --
- Fax
- --
- Country
- United States
- ProdList
- 6730
- Advantage
- 64
View Lastest Price from CECROPIN B manufacturers
- Product
- Cecropin B 80451-05-4
- Price
- US $0.10-0.30/kg
- Min. Order
- 1kg
- Purity
- >98%
- Supply Ability
- 20 tons
- Release date
- 2024-01-12