Basic information Application in Particular Diseases Safety Supplier Related
ChemicalBook >  Product Catalog >  Biochemical Engineering >  Amino Acids and Derivatives >  Other Amino Acid Protection >  Teriparatide acetate

Teriparatide acetate

Basic information Application in Particular Diseases Safety Supplier Related

Teriparatide acetate Basic information

Product Name:
Teriparatide acetate
Synonyms:
  • PARATHYROID HORMONE HUMAN: FRAGMENT 1-34
  • PARATHYROID HORMONE (HUMAN, 1-34)
  • PARATHYROID HORMONE (1-34), HUMAN
  • PTH (1-34) (HUMAN)
  • PTH (HUMAN, 1-34)
  • TERIPARATIDE
  • Teriparatide acetate
  • SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
CAS:
52232-67-4
MF:
C172H278N52O47S2
MW:
3890.49792
EINECS:
640-978-1
Product Categories:
  • Amino Acid Derivatives
  • EndocrinologyandHormones
  • Peptide
  • Hormones
  • Other Protein/Peptide Hormones
  • proteins
  • Parathyroid Hormone (PTH)Peptides and Proteins
  • Parathyroid Hormone Fragments
  • Peptides for Cell Biology
  • Peptides and Proteins
  • Various Peptides
Mol File:
52232-67-4.mol
More
Less

Teriparatide acetate Chemical Properties

RTECS 
SQ7770000
storage temp. 
−20°C
form 
powder
CAS DataBase Reference
52232-67-4(CAS DataBase Reference)
More
Less

Safety Information

WGK Germany 
3
HS Code 
2937190000
Hazardous Substances Data
52232-67-4(Hazardous Substances Data)

MSDS

More
Less

Teriparatide acetate Usage And Synthesis

Application in Particular Diseases

In Osteoporosis:

  • Teriparatide is a recombinant product representing the first 34 amino acids in human parathyroid hormone. Teriparatide increases bone formation, the bone remodeling rate, and osteoblast number and activity. Both bone mass and architecture are improved.
  • Teriparatide is FDA approved for postmenopausal women and men who are at high risk for fracture. Candidates for therapy include patients with a history of osteoporotic fracture, multiple risk factors for fracture, very low bone density (e.g., T-score <–3.5), or those who have failed or are intolerant of previous bisphosphonate therapy.
  • The drug reduces fracture risk in postmenopausal women, but no fracture data are available in men. Lumbar spine BMD increases are higher than with any other osteoporosis therapy. Although wrist BMD is decreased, wrist fractures are not increased.
  • Discontinuation of therapy results in a decrease in BMD, but some antifracture efficacy appears to be maintained. Sequential therapy with teriparatide followed by an antiresorptive agent (e.g., bisphosphonate) should be considered to maintain BMD gains.
  • The dose is 20 mcg administered subcutaneously in the thigh or abdominal area (see Table 3-4). The initial dose should be given with the patient either lying or sitting, in case orthostatic hypotension occurs. Each prefilled 3-mL pen device delivers a 20-mcg dose each day for up to 28 days; the pen device should be kept refrigerated.
  • Transient hypercalcemia rarely occurs. A trough serum calcium concentration is recommended 1 month after initiation of therapy.
  • Teriparatide is contraindicated in patients at baseline increased risk for osteosarcoma (e.g., Paget’s bone disease, unexplained alkaline phosphatase elevations, pediatric patients, young adults with open epiphyses, or patients with prior radiation therapy involving the skeleton).

Uses

A fragment of human parathyroid hormone (hPTH) peptide sequence containing the 34 N-terminal residues of hPTH. This fragment was also found to be an agonist at PTH1 and PTH2 receptors.

General Description

Teriparatide is a recombinantform of parathyroid hormone, which is used for the treatmentof osteoporosis in men and postmenopausal women.The N-terminal region possesses 34 amino acids, which areidentical to the biologically active region of the 84-aminoacid sequence of human parathyroid hormone. It has beenshown to act on osteoblasts to stimulate new bone growthand improve bone density.

Pharmacokinetics

If administered once daily or intermittently, teriparatide preferentially enhances osteoblastic function,and bone formation occurs. Continuous exposure to endogenous PTH may result in poor skeletal composition because of enhanced osteoclast-mediated bone resorption. After 18 months of treatment, lumbar BMD increased up to 12% in postmenopausal women. After 10 months of treatment, 53% of men had an increase of 5% or greater in spine BMD. The risk for developing new vertebral fractures was reduced by 65% after 21 months of treatment, and the number of nonvertebral fragility fractures was reduced by 53%.

Clinical Use

In 2002, the U.S. FDA approved teriparatide for the treatment of postmenopausal osteoporosis in patients who have a high risk of fracture as well as to increase bone mass in men with primary or hypogonadal osteoporosis who have a high risk of fracture. Teriparatide is recombinant human PTH 1-34, the biologically active portion of the endogenously produced preprohormone. Unlike the bisphosphonates, which are classified as bone restorative agents, teriparatide is the first approved bone-forming agent. Bone formation is possible because of the ability of this agent to increase the number of osteoblasts. Although teriparatide enhances the function of both osteoclasts and osteoblasts, the exposure incidence dictates its effect on the skeleton.

Side effects

Temporary increases in serum calcium levels occur following administration of teriparatide. As a result, this agent is contraindicated in patients who are predisposed to hypercalcemia. Some evidence suggests that these elevations in serum calcium levels may cause a patient who is taking digitalis to experience digitalis toxicity (39). Teriparatide should not be prescribed to patients with Paget's disease, children, young adults, women who are pregnant or nursing, and those patients who have received skeletal radiation therapy. Because of an increased incidence of osteosarcoma (malignant bone tumors) observed in rats, teriparatide also carries a black box warning

Teriparatide acetateSupplier

Avantpbc Chemical Tech(Shanghai) Co,Ltd. Gold
Tel
17802107445;021-3120-8408
Shanghai Mokay Pharmaceutical Technology Co., Ltd. Gold
Tel
021-60257269 18601606476
Email
yl@mkpharma.cn
Twochem Co.Ltd. Gold
Tel
021-58111628-
Email
sales@azbiochem.com
Hangzhou Xinhai Pharmaceutical Technology Co., Ltd. Gold
Tel
571-86758863-
Email
lulu@thinheal.com
Nanjing Hanxin Pharmaceutical Technology Co., Ltd. Gold
Tel
025-85807880-661
Email
fenglingn@amphastar.cn