ADRENOMEDULLIN (HUMAN)
- Product Name
- ADRENOMEDULLIN (HUMAN)
- CAS No.
- 148498-78-6
- Chemical Name
- ADRENOMEDULLIN (HUMAN)
- Synonyms
- ADM 1-52, HUMAN;humanadrenomedullin;ADRENOMEDULLIN (HUMAN);adrenomedullin 52 human;ADRENOMEDULLIN 1-52, HUMAN;Human adrenomedullin(1-52);Human adrenomedullin-(1-52)-NH2;Adrenomedullin (1-52) (human), vasodilating peptide;Adrenomedullin (human)/ADM (1-52) (human), Adrenomedullin (1-52), human;YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (DISULFIDE BRIDGE: 16-21)
- CBNumber
- CB4464257
- Molecular Formula
- C264H406N80O77S3
- Formula Weight
- 6028.73324
- MOL File
- 148498-78-6.mol
ADRENOMEDULLIN (HUMAN) Property
- storage temp.
- -20°C
- solubility
- Soluble at 1mg/ml in 1% acetic acid
- form
- powder
- Sequence
- H-Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2(Disulfide bond)
Safety
- WGK Germany
- 3
- RTECS
- AV6800000
- HS Code
- 2937190000
Hazard and Precautionary Statements (GHS)
- Symbol(GHS)
-
- Signal word
- Warning
- Hazard statements
-
H361Suspected of damaging fertility or the unborn child
- Precautionary statements
-
P201Obtain special instructions before use.
P202Do not handle until all safety precautions have been read and understood.
P281Use personal protective equipment as required.
P308+P313IF exposed or concerned: Get medical advice/attention.
P405Store locked up.
P501Dispose of contents/container to..…
N-Bromosuccinimide Price
- Product number
- A2327
- Product name
- Adrenomedullin 52 human
- Purity
- ≥90% (HPLC), powder
- Packaging
- 0.1MG
- Price
- $604
- Updated
- 2024/03/01
- Product number
- J66379
- Product name
- Adrenomedullin (1-52), human
- Packaging
- 1mg
- Price
- $1030
- Updated
- 2023/06/20
- Product number
- 301857
- Product name
- Adrenomedullin, Human
- Packaging
- 100ug
- Price
- $515
- Updated
- 2021/12/16
- Product number
- A0909-40B
- Product name
- Adrenomedullin, Human
- Packaging
- 100ug
- Price
- $347
- Updated
- 2021/12/16
- Product number
- FA108807
- Product name
- Adrenomedullin (human) trifluoroacetate salt H-Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 trifluoroacetate salt (Disulfide bond)
- Packaging
- 500ug
- Price
- $505
- Updated
- 2021/12/16
ADRENOMEDULLIN (HUMAN) Chemical Properties,Usage,Production
Uses
Peptide elicits potent hypotensive effect, comparable to calcitonin gene-related peptide. Plays a key role in regulating endometrial angiogenesis.
General Description
Adrenomedullin (ADM) human comprises of 52 amino acids and has amine group in the C-terminal tyrosine residue. It also has a N-terminal ring structure and belongs to calcitonin peptide family. ADM has vasodilatory function and is mapped to human chromosome 11p15.4. Adrenomedullin is highly expressed in endothelial cells. Adrenomedullin controls a majority of cellular processes using cyclic adenosine monophosphate (cAMP) as a messenger. It interacts with calcitonin receptor-like receptor (CRLR) and receptor activity modifying protein 2 (RAMP2). ADM contributes to invasion activity in brain tumor cell lines. ADM signalling plays a key role in tumor progression, especially in acute myeloid leukemia.
Biochem/physiol Actions
Peptide elicits potent hypotensive effect, comparable to calcitonin gene-related peptide. Plays a key role in regulating endometrial angiogenesis.
ADRENOMEDULLIN (HUMAN) Preparation Products And Raw materials
Raw materials
Preparation Products
ADRENOMEDULLIN (HUMAN) Suppliers
- Tel
- 21-61263452 13641803416
- Fax
- 86-21-61263399
- ymbetter@glbiochem.com
- Country
- China
- ProdList
- 9981
- Advantage
- 64
- Tel
- 021-54306202 13764082696
- info@hanhongsci.com
- Country
- China
- ProdList
- 42958
- Advantage
- 64
- Tel
- 021-50135380
- shchemsky@sina.com
- Country
- China
- ProdList
- 32321
- Advantage
- 50
- Tel
- 0551-65326643 18156095617
- Fax
- 0551-65326641
- info@cellmano.com
- Country
- China
- ProdList
- 1011
- Advantage
- 55
- Tel
- 0510-85629785 18013409632
- Fax
- 051085625359
- sales@reading-chemicals.com
- Country
- China
- ProdList
- 15178
- Advantage
- 58
- Tel
- 0571-89197072; 18668118770
- Fax
- 0571-89197072
- linda@peptide-china.com
- Country
- China
- ProdList
- 248
- Advantage
- 56
- Tel
- 021-61415566 800-8193336
- orderCN@merckgroup.com
- Country
- China
- ProdList
- 51456
- Advantage
- 80
- Tel
- info@creative-peptides.com
- Country
- United States
- ProdList
- 6083
- Advantage
- 56
- Tel
- 17705183659
- Fax
- 84523390
- sales@njleonbiotech.com
- Country
- China
- ProdList
- 5501
- Advantage
- 55
- Tel
- 025-025-58361106-805-805 13082558573
- Fax
- 025-58361106-806
- liugang@njpeptide.com
- Country
- China
- ProdList
- 9980
- Advantage
- 55
View Lastest Price from ADRENOMEDULLIN (HUMAN) manufacturers
- Product
- Adrenomedullin (1-52), human 148498-78-6
- Price
- US $0.10-0.30/kg
- Min. Order
- 1kg
- Purity
- ≥98.0%
- Supply Ability
- 20 tons
- Release date
- 2024-01-04
- Product
- Adrenomedullin (human) 148498-78-6
- Price
- US $0.10-0.30/kg
- Min. Order
- 1kg
- Purity
- 99%
- Supply Ability
- 20 tons
- Release date
- 2024-01-04
- Product
- ADRENOMEDULLIN (HUMAN) 148498-78-6
- Price
- US $7.00/KG
- Min. Order
- 1KG
- Purity
- 99%
- Supply Ability
- 100kg
- Release date
- 2020-02-13