ACTH (7-38) (HUMAN)
- Product Name
- ACTH (7-38) (HUMAN)
- CAS No.
- 68563-24-6
- Chemical Name
- ACTH (7-38) (HUMAN)
- Synonyms
- ACTH 1-39;acth(7-38;CIP (HUMAN);CORTICOTROPIN A;ACTH (7-38) Tfa;ACTH (7-38) (HUMAN);ACTH (7-38), human - 1 mg;ACTH (7-38) (HUMAN) USP/EP/BP;FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE;CORTICOTROPIN-INHIBITING PEPTIDE
- CBNumber
- CB6367152
- Molecular Formula
- C167H257N47O46
- Formula Weight
- 3659.11
- MOL File
- Mol file
ACTH (7-38) (HUMAN) Property
- storage temp.
- −20°C
- form
- Solid
- color
- White to off-white
- Sequence
- H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH
Safety
- Safety Statements
- 22-24/25
- WGK Germany
- 3
- Storage Class
- 11 - Combustible Solids
N-Bromosuccinimide Price
- Product number
- A1527
- Product name
- Adrenocorticotropic Hormone Fragment 7-38 human
- Purity
- ≥97% (HPLC)
- Packaging
- 250μg
- Price
- $219.67
- Updated
- 2025/07/31
- Product number
- A1527
- Product name
- Adrenocorticotropic Hormone Fragment 7-38 human
- Purity
- ≥97% (HPLC)
- Packaging
- 0.5mg
- Price
- $374
- Updated
- 2025/07/31
- Product number
- A1527
- Product name
- Adrenocorticotropic Hormone Fragment 7-38 human
- Purity
- ≥97% (HPLC)
- Packaging
- 1mg
- Price
- $612
- Updated
- 2025/07/31
- Product number
- C7903-80F
- Product name
- Corticotropin Inhibiting Peptide
- Packaging
- 1mg
- Price
- $262
- Updated
- 2021/12/16
- Product number
- FA108380
- Product name
- ACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH
- Packaging
- 500ug
- Price
- $130
- Updated
- 2021/12/16
ACTH (7-38) (HUMAN) Chemical Properties,Usage,Production
Uses
Adrenocorticotropic hormone fragment 7-38 human has been used as astandard in external calibration for mass spectrometry.
Biological Activity
Adrenocorticotropic hormone (ACTH) is a polypeptide hormone thatstimulates adrenocortical activity. It is produced by the prohormoneproopiomelanocortin (POMC), which is synthesized in the corticotroph andmelanotroph cells found in the intermediate and anterior lobe of the pituitarygland and the arcuate nucleus of the hypothalamus. ACTH is also synthesized inthe skin. It plays a role in controlling steroidogenesis in the adrenal glandand prevents reactive oxygen species (ROS)-induced cell toxicity. Higher levelsof ACTH lead to skin hyperpigmentation due to the hyperstimulation ofmelanocytes, characteristic of primary adrenal insufficiency (PAI). Deficiencyof ACTH synthesis, receptors, or signaling is associated with adrenalinsufficiency.
ACTH (7-38) (HUMAN) Preparation Products And Raw materials
Raw materials
Preparation Products
ACTH (7-38) (HUMAN) Suppliers
- Tel
- 21-61263452 13641803416
- Fax
- 86-21-61263399
- ymbetter@glbiochem.com
- Country
- China
- ProdList
- 9981
- Advantage
- 64
- Tel
- 025-83697070 13913916777;
- Fax
- +86-25-83453306
- info@chemlin.com.cn
- Country
- China
- ProdList
- 15724
- Advantage
- 64
- Tel
- 021-54306202 13764082696
- info@hanhongsci.com
- Country
- China
- ProdList
- 42934
- Advantage
- 64
- Tel
- 021-50135380
- shchemsky@sina.com
- Country
- China
- ProdList
- 32321
- Advantage
- 50
- Tel
- 0551-65326643 18156095617
- Fax
- 0551-65326641
- info@cellmano.com
- Country
- China
- ProdList
- 1010
- Advantage
- 55
- Tel
- 1-631-485-4226; 16314854226
- info@bocsci.com
- Country
- United States
- ProdList
- 12952
- Advantage
- 65
- Tel
- 0510-85629785 18013409632
- Fax
- 051085625359
- sales@reading-chemicals.com
- Country
- China
- ProdList
- 15178
- Advantage
- 58
- Tel
- 021-61415566 800-8193336
- orderCN@merckgroup.com
- Country
- China
- ProdList
- 51395
- Advantage
- 80
- Tel
- 17705183659
- Fax
- 84523390
- sales@njleonbiotech.com
- Country
- China
- ProdList
- 5501
- Advantage
- 55
- Tel
- 025-58361106-805 15951641583
- Fax
- 025-58361106-806
- zhao.xu@njpeptide.com
- Country
- China
- ProdList
- 9979
- Advantage
- 55
View Lastest Price from ACTH (7-38) (HUMAN) manufacturers
- Product
- ACTH (7-38) (human) 68563-24-6
- Price
- US $0.10-0.30/kg
- Min. Order
- 1kg
- Purity
- >98%
- Supply Ability
- 20 tons
- Release date
- 2024-01-03
- Product
- ACTH (7- 38), human 68563-24-6
- Price
- US $0.10-0.30/kg
- Min. Order
- 1kg
- Purity
- 98%
- Supply Ability
- 20 tons
- Release date
- 2024-01-04
- Product
- ACTH (7-38) (HUMAN) 68563-24-6
- Price
- US $7.00/KG
- Min. Order
- 1KG
- Purity
- 99%
- Supply Ability
- 100kg
- Release date
- 2020-02-18