LL-37

ChemicalBook > CAS DataBase List > LL-37

Structure

Product Name: LL-37
CAS No.: 154947-66-7
Chemical Name: LL-37
Synonyms: II37 Peptide;LL-37, LL37, CAMP;Cathelicidin LL-37;LL-37 human acetate;LL37 (Human cathelicidin);Cathelicidin LL 37 (human);LL-37 (trifluoroacetate salt);Antibacterial Protein LL-37 (human);[LL-37, 37 aa];Antibacterial Protein LL-37 (huMan), LL37, CAMP
CBNumber: CB02603131
Molecular Formula: C205H340N60O53
Formula Weight: 0
MOL File: Mol file

Less

LL-37 Property

solubility: Water: 1 mg/ml
form: A lyophilized powder
color: White to off-white
Water Solubility: Soluble to 1 mg/ml in water
InChI: InChI=1S/C205H340N60O53/c1-20-114(16)162(261-179(296)128(66-40-46-86-211)235-176(293)135(74-78-155(273)274)243-170(287)125(63-37-43-83-208)241-192(309)148(106-266)257-174(291)126(64-38-44-84-209)234-171(288)129(67-47-87-225-201(215)216)240-185(302)142(98-119-55-29-24-30-56-119)252-187(304)144(100-121-59-33-26-34-60-121)253-189(306)146(102-158(279)280)233-154(272)104-230-167(284)138(94-109(6)7)248-166(283)122(212)93-108(4)5)194(311)231-105-153(271)232-123(61-35-41-81-206)168(285)242-136(75-79-156(275)276)177(294)251-141(97-118-53-27-23-28-54-118)184(301)238-124(62-36-42-82-207)169(286)236-131(69-49-89-227-203(219)220)181(298)263-164(116(18)22-3)197(314)259-160(112(12)13)195(312)246-134(73-77-151(213)269)175(292)237-132(70-50-90-228-204(221)222)180(297)262-163(115(17)21-2)196(313)245-127(65-39-45-85-210)172(289)256-147(103-159(281)282)190(307)254-143(99-120-57-31-25-32-58-120)186(303)249-139(95-110(8)9)183(300)239-130(68-48-88-226-202(217)218)173(290)255-145(101-152(214)270)188(305)250-140(96-111(10)11)191(308)260-161(113(14)15)199(316)265-92-52-72-150(265)193(310)244-133(71-51-91-229-205(223)224)182(299)264-165(117(19)268)198(315)247-137(76-80-157(277)278)178(295)258-149(107-267)200(317)318/h23-34,53-60,108-117,122-150,160-165,266-268H,20-22,35-52,61-107,206-212H2,1-19H3,(H2,213,269)(H2,214,270)(H,230,284)(H,231,311)(H,232,271)(H,233,272)(H,234,288)(H,235,293)(H,236,286)(H,237,292)(H,238,301)(H,239,300)(H,240,302)(H,241,309)(H,242,285)(H,243,287)(H,244,310)(H,245,313)(H,246,312)(H,247,315)(H,248,283)(H,249,303)(H,250,305)(H,251,294)(H,252,304)(H,253,306)(H,254,307)(H,255,290)(H,256,289)(H,257,291)(H,258,295)(H,259,314)(H,260,308)(H,261,296)(H,262,297)(H,263,298)(H,264,299)(H,273,274)(H,275,276)(H,277,278)(H,279,280)(H,281,282)(H,317,318)(H4,215,216,225)(H4,217,218,226)(H4,219,220,227)(H4,221,222,228)(H4,223,224,229)/t114-,115-,116-,117+,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,139-,140-,141-,142-,143-,144-,145-,146-,147-,148-,149-,150-,160-,161-,162-,163-,164-,165-/m0/s1
InChIKey: POIUWJQBRNEFGX-XAMSXPGMSA-N
SMILES: O=C([C@]([H])(C([H])(C([H])([H])[H])C([H])([H])[H])N([H])C([C@]([H])(C([H])([H])C([H])(C([H])([H])[H])C([H])([H])[H])N([H])C([C@]([H])(C([H])([H])C(N([H])[H])=O)N([H])C([C@]([H])(C([H])([H])C([H])([H])C([H])([H])N([H])/C(=N/[H])/N([H])[H])N([H])C([C@]([H])(C([H])([H])C([H])(C([H])([H])[H])C([H])([H])[H])N([H])C([C@]([H])(C([H])([H])C1C([H])=C([H])C([H])=C([H])C=1[H])N([H])C([C@]([H])(C([H])([H])C(=O)O[H])N([H])C([C@]([H])(C([H])([H])C([H])([H])C([H])([H])C([H])([H])N([H])[H])N([H])C([C@]([H])([C@@]([H])(C([H])([H])[H])C([H])([H])C([H])([H])[H])N([H])C([C@]([H])(C([H])([H])C([H])([H])C([H])([H])N([H])/C(=N/[H])/N([H])[H])N([H])C([C@]([H])(C([H])([H])C([H])([H])C(N([H])[H])=O)N([H])C([C@]([H])(C([H])(C([H])([H])[H])C([H])([H])[H])N([H])C([C@]([H])([C@@]([H])(C([H])([H])[H])C([H])([H])C([H])([H])[H])N([H])C([C@]([H])(C([H])([H])C([H])([H])C([H])([H])N([H])/C(=N/[H])/N([H])[H])N([H])C([C@]([H])(C([H])([H])C([H])([H])C([H])([H])C([H])([H])N([H])[H])N([H])C([C@]([H])(C([H])([H])C1C([H])=C([H])C([H])=C([H])C=1[H])N([H])C([C@]([H])(C([H])([H])C([H])([H])C(=O)O[H])N([H])C([C@]([H])(C([H])([H])C([H])([H])C([H])([H])C([H])([H])N([H])[H])N([H])C(C([H])([H])N([H])C([C@]([H])([C@@]([H])(C([H])([H])[H])C([H])([H])C([H])([H])[H])N([H])C([C@]([H])(C([H])([H])C([H])([H])C([H])([H])C([H])([H])N([H])[H])N([H])C([C@]([H])(C([H])([H])C([H])([H])C(=O)O[H])N([H])C([C@]([H])(C([H])([H])C([H])([H])C([H])([H])C([H])([H])N([H])[H])N([H])C([C@]([H])(C([H])([H])O[H])N([H])C([C@]([H])(C([H])([H])C([H])([H])C([H])([H])C([H])([H])N([H])[H])N([H])C([C@]([H])(C([H])([H])C([H])([H])C([H])([H])N([H])/C(=N/[H])/N([H])[H])N([H])C([C@]([H])(C([H])([H])C1C([H])=C([H])C([H])=C([H])C=1[H])N([H])C([C@]([H])(C([H])([H])C1C([H])=C([H])C([H])=C([H])C=1[H])N([H])C([C@]([H])(C([H])([H])C(=O)O[H])N([H])C(C([H])([H])N([H])C([C@]([H])(C([H])([H])C([H])(C([H])([H])[H])C([H])([H])[H])N([H])C([C@]([H])(C([H])([H])C([H])(C([H])([H])[H])C([H])([H])[H])N([H])[H])=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)N1C([H])([H])C([H])([H])C([H])([H])[C@@]1([H])C(N([H])[C@]([H])(C(N([H])[C@]([H])(C(N([H])[C@]([H])(C(N([H])[C@]([H])(C(=O)O[H])C([H])([H])O[H])=O)C([H])([H])C([H])([H])C(=O)O[H])=O)[C@@]([H])(C([H])([H])[H])O[H])=O)C([H])([H])C([H])([H])C([H])([H])N([H])/C(=N/[H])/N([H])[H])=O

Less

Hazard and Precautionary Statements (GHS)

Less

N-Bromosuccinimide Price

Cayman Chemical

Product number: 24461
Product name: LL-37 (trifluoroacetate salt)
Purity: ≥95%
Packaging: 500μg
Price: $167
Updated: 2023/06/20

Cayman Chemical

Product number: 24461
Product name: LL-37 (trifluoroacetate salt)
Purity: ≥95%
Packaging: 1mg
Price: $315
Updated: 2023/06/20

ApexBio Technology

Product number: B7771
Product name: LL37
Packaging: 1mg
Price: $366
Updated: 2021/12/16

ApexBio Technology

Product number: B7771
Product name: LL37
Packaging: 500ug
Price: $193
Updated: 2021/12/16

Less

LL-37 Chemical Properties,Usage,Production

Structure

The structure of LL-37 in SDS micelles is composed of a curved amphipathic helix-bend-helix motif spanning residues 2–31 followed by a disordered C-terminal tail. The helical bend is located between residues Gly-14 and Glu-16. Similar chemical shifts and 15N nuclear Overhauser effect (NOE) patterns of the peptide in complex with di octanoyl phosphatidylglycerol (D8PG) micelles indicate a similar structure. The aromatic rings of Phe-5, Phe-6, Phe-17, and Phe-27 of LL-37, as well as arginines, showed intermolecular NOE cross-peaks with D8PG, providing direct evidence for the association of the entire amphipathic helix with anionic lipid micelles. The structure of LL-37 serves as a model for understanding the structure and function relationship of homologous primate cathelicidins[5].

Description

LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

Uses

L 37 (human) is a 37 amino acid host defense peptide originating from the C-terminal of the human cathelicidin antimicrobial peptide (CAMP, hCAP18). This peptide possesses antimicrobial, antitumor, antiviral, and immunomodulatory properties, along with physiological functions in chemotaxis, wound healing, and angiogenesis. Beyond its antimicrobial capabilities, LL 37 (human) influences various pathways in autoimmune and inflammatory diseases, playing a role in the development of lupus, rheumatoid arthritis, and atherosclerosis. As a binding partner to Aβ42, the expression of LL 37 (human) affects the onset and progression of Alzheimer's disease. Additionally, LL 37 has a notable role in human cancer, promoting tumorigenic effects in ovarian, lung, breast, prostate, pancreatic cancers, and malignant melanoma.

Origin

Mammalian AMPs belong to the defensin and cathelicidin families. So far, there is a unique cathelicidin peptide found in 1995 and called human cationic antimicrobial peptide (hCAP18). Its active part starts with double leucine and consists of 37-amino acids at the C-terminus, so which is called LL-37.

benefits

LL-37 is an important part of the human immune system, which can resist various pathogens. A plethora of experiments have demonstrated that it has the multifunctional effects of immune regulation, in addition to antimicrobial activity. Significantly boosts immune function; Fights inflammation; Prevents cancer progression; Accelerates wound healing; Lowers the risk of heart disease; Prevents lung injury; Promotes bone repair.

Biological Activity

LL 37 is an antimicrobial peptide derivative of human cathelicidin. Induces FPRL1-mediated chemotaxis of human neutrophils, monocytes and T cells in vitro. Promotes wound healing following skin-targeted electroporation of a plasmid encoding hCAP-18/LL-37 in mice. LL 37 reduces SARS-CoV-2 infection by blocking the receptor binding domain of the S1 spike protein (Kd = 11.2 nM) and by binding to ACE2 (Kd = 25.5.nM). LL 37 inhibits SARS-CoV-2 pseudovirion infection (IC50 = 4.74 μg/mL) in vitro and in vivo. Also triggers apoptosis in colon cancer cells. Cell permeable.

Side effects

LL-37 side effects are very uncommon. LL-37 induced apparent rosacea symptoms, erythema, and telangiectasia on the skin. Side effects associated with LL-37 may include the following:
Increased inflammation
Induction of autoimmune disease
Depression
Damage to sperm surface membranes

storage

Store at -20°C

References

[1]Kahlenberg and Kaplan (2013) Little peptide, big effects: the role of LL-37 in inflammation and autoimmune disease. J. Immunol. 191(10) 4895 PMID: 24185823
[2]Bandurska et al (2015) Unique features of human cathelicidin LL‐37. BioFactors 41 289 PMID: 26434733
[3]Chen et al (2018) Roles and Mechanisms of Human Cathelicidin LL-37 in Cancer. Cell Physiol.Biochem. 47 1060 PMID: 29843147
[4]Vierthaler et al (2020) Fluctuating role of antimicrobial peptide hCAP18/LL?37 in oral tongue dysplasia and carcinoma. Oncol. Rep. 44 325 PMID: 32627035
[5]Wang, Guangshun. “Structures of human host defense cathelicidin LL-37 and its smallest antimicrobial peptide KR-12 in lipid micelles.” The Journal of Biological Chemistry 283 47 (2008): 32637–43.

LL-37 Preparation Products And Raw materials

Raw materials

Preparation Products

Less

LL-37 Suppliers

China 109 United Kingdom 1 United States 6 USA 1 Global 117

Cellmano Biotech Limited

Tel: 0551-65326643 18156095617
Fax: 0551-65326641
Email: info@cellmano.com
Country: China
ProdList: 1011
Advantage: 55

Sichuan Taihui Biotechnology Co., Ltd

Tel: 028-87189093 18599944286
Email: 272503470@qq.com
Country: China
ProdList: 99
Advantage: 58

Chemsky (shanghai) International Co.,Ltd

Tel: 021-50135380
Email: shchemsky@sina.com
Country: China
ProdList: 15402
Advantage: 60

ShangHai Caerulum Pharma Discovery Co., Ltd.

Tel: 18149758185 18149758185
Email: sales-cpd@caerulumpharma.com
Country: China
ProdList: 3466
Advantage: 58

Wuxi Zhongkun Biochemical Technology Co., Ltd.

Tel: 0510-85629785 18013409632
Fax: 051085625359
Email: sales@reading-chemicals.com
Country: China
ProdList: 15178
Advantage: 58

ShangHai Biochempartner Co.,Ltd

Tel: 177-54423994 17754423994
Fax: QQ:2853530913
Email: 2853530910@QQ.com
Country: China
ProdList: 8011
Advantage: 62

Shanghai Chaolan Chemical Technology Center

Tel: 021-QQ：65489617 15618227136
Fax: 21-5161 9052
Email: Sales@ATKchemical.com
Country: China
ProdList: 7267
Advantage: 58

Beijing Solarbio Science & Tecnology Co., Ltd.

Tel: 010-50973130 4009686088
Email: 3193328036@qq.com
Country: China
ProdList: 29785
Advantage: 68

Nanjing Leon Biological Technology Co., Ltd.

Tel: 17705183659
Fax: 84523390
Email: sales@njleonbiotech.com
Country: China
ProdList: 5501
Advantage: 55

Nanjing Peptide Biotech Ltd.

Tel: 025-025-58361106-805-805 13082558573
Fax: 025-58361106-806
Email: liugang@njpeptide.com
Country: China
ProdList: 9980
Advantage: 55

Chengdu Youngshe Chemical Co., Ltd.

Tel: +86-17380623303 +86-17380623303
Fax: 028-62328193
Email: Caroline@youngshechem.com
Country: China
ProdList: 4841
Advantage: 58

Hubei widely chemical technology Co., Ltd.

Tel: 027-83778895 18602735115
Fax: 027-51119224
Email: 18602735115@163.com
Country: China
ProdList: 1993
Advantage: 64

Nanjing NingFan Pharm-Tech CO. LTD.

Tel: 17368696818
Country: China
ProdList: 1984
Advantage: 58

Hangzhou Peptidego Biotech Co.,Ltd.

Tel: 0571-87213919
Fax: 0571-87213919
Email: Eric@peptidego.com
Country: China
ProdList: 6756
Advantage: 58

Sichuan Jisheng Biopharmaceutical Co.,Ltd.

Tel: +86-0833-2598983 +86-18086877136
Fax: +86-833-2598903
Email: Nyx-peptide@jsjpharm.cn
Country: China
ProdList: 309
Advantage: 58

Nanjing Meihao Pharmaceutical Technology Co., Ltd.

Tel: meitaochem@126.com
Email: meitaochem@126.com
Country: China
ProdList: 19103
Advantage: 58

Shanghai UCHEM Inc.

Tel: +862156762820 +86-13564624040
Email: sales@myuchem.com
Country: China
ProdList: 7514
Advantage: 58

Shanghai Yunao International Trade Co., Ltd

Tel: +8617621705551
Email: asdf@shanghaihg.cn
Country: China
ProdList: 264
Advantage: 58

Zhejiang J&C Biological Technology Co.,Limited

Tel: +1-2135480471 +1-2135480471
Email: sales@sarms4muscle.com
Country: China
ProdList: 10473
Advantage: 58

Hong Kong Excellence Biotechnology Co., Ltd.

Tel
Fax: wickrme：chemical888
Email: ada@sh-teruiop.com
Country: China
ProdList: 875
Advantage: 58

Hubei Ipure Biology Co., Ltd

Tel: +8613367258412
Fax: 18062427325
Email: ada@ipurechemical.com
Country: China
ProdList: 10319
Advantage: 58

Hangzhou Go Top Peptide Biotech

Tel: 0571-88211921
Email: sales1@gotopbio.com
Country: CHINA
ProdList: 2609
Advantage: 58

HONG KONG IPURE BIOLOGY CO.,LIMITED

Tel: 86 18062405514 18062405514
Email: ada@ipurechemical.com
Country: CHINA
ProdList: 3461
Advantage: 58

Binhai gill polypeptide co. LTD

Tel: 021-61263389 13524856427
Fax: WeChat630417570
Email: Joetang@glschina.com
Country: China
ProdList: 9976
Advantage: 58

DC Chemicals

Tel: 021-58447131 13564518121
Email: sales@dcchemicals.com
Country: China
ProdList: 9409
Advantage: 58

ChemeGen(Shanghai) Biotechnology Co.,Ltd.

Tel: 18818260767
Fax: QQ 3610331285
Email: sales@chemegen.com
Country: China
ProdList: 11217
Advantage: 58

career henan chemical co

Tel: +86-0371-86658258 +8613203830695
Fax: 0086-371-86658258
Email: factory@coreychem.com
Country: China
ProdList: 29811
Advantage: 58

Nanjing chengqimei Biotechnology Co., Ltd

Tel: 19850819832
Email: 2173594524@qq.com
Country: China
ProdList: 2638
Advantage: 58

Absin Bioscience Inc.

Tel: 021-38015121 15000105423
Email: wulan@absin.cn
Country: China
ProdList: 24731
Advantage: 58

Xi'an Lyna Bio-Tech Co., Ltd.

Tel: 029-84161958 18629577295
Fax: 029-84161958
Email: magic@lynabio.com
Country: China
ProdList: 1071
Advantage: 55

Nanchang Tianzhen Biotechnology Co., Ltd

Tel: 13173652190
Email: pomy@tanzhenbio.com
Country: China
ProdList: 1775
Advantage: 58

Wuxi Helen Biotechnology Co., Ltd.,

Tel: 0510-85629785 18013409632
Fax: 0510-85625359
Email: sales@reading-chemicals.com
Country: China
ProdList: 14081
Advantage: 58

Nanjing TGpeptide Biotechnology Co.,Ltd.

Tel: 18115476705
Email: sales@tgpeptide.com
Country: China
ProdList: 3058
Advantage: 58

Wuhan Dingxintong Pharmaceutical Co. , Ltd.

Tel: 027-027-52344656 15871722230
Fax: 2796190295
Email: 15871722230@163.com
Country: China
ProdList: 4855
Advantage: 58

Ontores Biotech

Tel: 0571-88760729 18072970094
Email: supports@ontorespeptide.com
Country: China
ProdList: 2696
Advantage: 58

Wuhan Wiseman Bioengineering Co.,Ltd

Tel: 027-59506022 13419526507
Fax: 027-59506022
Email: 13419526507@163.com
Country: China
ProdList: 2945
Advantage: 58

Hangzhou Go Top Peptide Biotech

Tel: 0571-88211921 13355716090
Email: Sales@gotopbio.com
Country: China
ProdList: 2859
Advantage: 58

MedBioPharmaceutical Technology Inc

Tel: 021-69568360 18916172912
Email: order@med-bio.cn
Country: China
ProdList: 8140
Advantage: 58

cjbscvictory

Tel: 13348960310 13348960310
Email: 3003867561@qq.com
Country: China
ProdList: 10002
Advantage: 58

Abmole Bioscience Inc.

Tel: 021-50967598 02150967598
Email: sales@abmole.cn
Country: China
ProdList: 4494
Advantage: 58

TCI (Shanghai) Chemical Trading Co., Ltd.

Tel: 021-021-61109150
Fax: 021-61105897
Email: sales@tcisct.com
Country: China
ProdList: 31121
Advantage: 58

Wuhan DKY Technology Co.,Ltd.

Tel: 027-81302411 15377658509
Email: zs@dkybpc.com
Country: China
ProdList: 2196
Advantage: 58

Hubei Kele Fine Chemical Co., Ltd

Tel: 027-59101668 19945030958
Fax: 027-59101668
Email: 2881924765@qq.com
Country: China
ProdList: 8140
Advantage: 58

Molcoo Chemicals Inc.

Tel: 18627756402
Email: 3001051413@qq.com
Country: China
ProdList: 9544
Advantage: 58

Nanjing Yuanpeptide Biotech Co.，Ltd.

Tel: 18168071971
Email: support@yuan-peptide.com
Country: China
ProdList: 2979
Advantage: 58

Chengdu Jinglin Biotechnology Co., Ltd.

Tel: 17711399154
Email: 3211919385@qq.com
Country: China
ProdList: 1815
Advantage: 58

Shaoxing Junyu Biotechnology Co., LTD

Tel: 0571-88211921 15572296305
Email: sales4@gotopbio.com
Country: China
ProdList: 5128
Advantage: 58

Wuhan Yingnuo Pharmaceutical Technology Co., Ltd.

Tel: +86-027-59232304 15387063101
Email: 2881924050@qq.com
Country: China
ProdList: 9951
Advantage: 58

TargetMol Chemicals Inc.

Tel: 4008200310
Email: marketing@tsbiochem.com
Country: China
ProdList: 24647
Advantage: 58

Hangzhou Sinoda Pharmaceutical Technology Co. LTD

Tel: 0571-87213919 17306812703
Email: 3007955328@qq.com
Country: China
ProdList: 6445
Advantage: 58

Less

View Lastest Price from LL-37 manufacturers

Dorne Chemical Technology co. LTD

Product: LL-37 154947-66-7
Price: US $1.00/g
Min. Order: 1g
Purity: 99%
Supply Ability: 100kg
Release date: 2024-03-26

CONTIDE BIOTECH CO.,LTD

Product: LL37 154947-66-7
Price: US $0.00/G
Min. Order: 1G
Purity: 99%
Supply Ability: 5kg
Release date: 2024-10-17

hebei hongtan Biotechnology Co., Ltd

Product: LL37 154947-66-7
Price: US $60.00-40.00/BOX
Min. Order: 1BOX
Purity: 99.99%
Supply Ability: 1000
Release date: 2024-03-14

154947-66-7, LL-37Related Search:

AC-MURAMYL-ALA-GLU-NH2 andropin N-(9-Fluorenylmethoxycarbonyloxy)succinimide GAP 26 Prezatide copper acetate ADRENOMEDULLIN (16-31) (HUMAN, PIG) Thymosin α1 Acetyl Octapeptide-3 N-BOC-L-leucylglycyl-arginine-p-nitroanilide hydrochloride H-LEU-ARG-ALA-HIS-ALA-VAL-ASP-VAL-ASN-GLY-NH2 Degarelix Palmitoyl Pentapeptide ADRENOMEDULLIN (HUMAN) Argireline Plecanatide Amyloid β-Peptide (1-42) (human) Dulaglutide Polybia-MP1 trifluoroacetate salt

Antibacterial Protein LL-37 (huMan), LL37, CAMP

H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH

Antibacterial Protein LL-37 (human)

LL-37 (trifluoroacetate salt)

[LL-37, 37 aa]

Cathelicidin LL 37 (human)

LL-37, LL37, CAMP

LL-37 human acetate

Cathelicidin LL-37

Anti-Inflammatory Peptide Ll-37 (human) /Cathelicidin Ll-37

II37 Peptide

LL37 (Human cathelicidin)

154947-66-7

C205H340N60O53